HHsearch alignment for GI: 255764471 and conserved domain: COG3596

>COG3596 Predicted GTPase [General function prediction only].
Probab=99.59  E-value=3.5e-15  Score=121.28  Aligned_cols=190  Identities=16%  Similarity=0.155  Sum_probs=128.0

Q ss_pred             CCCCEEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCEEEEEEECHHCCCCCCCCCHHHHHHCCCC
Q ss_conf             44430388640356425678876520121100024566542023114203406999817110444443000111000121
Q gi|255764471|r  200 ISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKS  279 (470)
Q Consensus       200 ~~~~i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~~~~~~~~liDTaGirkk~~~~~~~E~~s~~~t  279 (470)
T Consensus        36 ~~~pvnvLi~G~TG~GKSSliNALF~~~~~~v~~vg~~t~~~~~~~~~~~~~~l~lwDtPG~gdg~~~D~~~r~-~~---  111 (296)
T COG3596          36 EKEPVNVLLMGATGAGKSSLINALFQGEVKEVSKVGVGTDITTRLRLSYDGENLVLWDTPGLGDGKDKDAEHRQ-LY---  111 (296)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHH-HH---
T ss_conf             36861589743777768899999970267342104668870156774126652488437885532022189999-99---


Q ss_pred             CEEEECCEEEEEECCCCCCCHHHHHHHHHHHHCC--CCCCCEEEECCCCCCCH-----------HHHHHHHHHH---CCC
Q ss_conf             0012012059984553212202122320000003--57665589442233541-----------5556665420---133
Q gi|255764471|r  280 MQSVRTCETTIVLLDATIPFEKQDLRIVDSVFNT--GHAVVLALNKWDMVSDK-----------LNLLQDLRTK---AIK  343 (470)
Q Consensus       280 ~~~i~~advvi~viDa~~~~~~qd~~i~~~i~~~--~k~~iiv~NK~Dli~~~-----------~~~~~~~~~~---~~~  343 (470)
T Consensus       112 ~d~l~~~DLvL~l~~~~draL~~d~~f~~dVi~~~~~~~~i~~VtQ~D~a~p~~~W~~~~~~p~~a~~qfi~~k~~~~~~  191 (296)
T COG3596         112 RDYLPKLDLVLWLIKADDRALGTDEDFLRDVIILGLDKRVLFVVTQADRAEPGREWDSAGHQPSPAIKQFIEEKAEALGR  191 (296)
T ss_pred             HHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             98863224799961477700147799999999860576069997366543655430002599987899999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             3200488311123453334858999999999998414689789899999999
Q gi|255764471|r  344 NLPQIGDIYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQ  395 (470)
Q Consensus       344 ~~~~~~~~~i~~iSA~~g~gi~~l~~~i~~~~~~~~~ri~T~~LN~~l~~~~  395 (470)
T Consensus       192 ~~q--~V~pV~~~~~r~~wgl~~l~~ali~~lp~e~rs~~a~~~~d~~~~~~  241 (296)
T COG3596         192 LFQ--EVKPVVAVSGRLPWGLKELVRALITALPVEARSPLAARLQDELRTQS  241 (296)
T ss_pred             HHH--HCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             876--31774775254676689999999986731002402433016877777