>cd00880 Era_like Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se

Probab=100.00 E-value=1.1e-33 Score=246.07 Aligned_cols=154 Identities=24% Similarity=0.380 Sum_probs=101.1 Q ss_pred EECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECC-EEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCE Q ss_conf 9718988788899998588501025898530223899999899-899999658842076368999999999999987798 Q gi|255764471|r 7 IVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIING-VIFNIVDTAGIADGKNCSIAKQMNDQTELAINEAHL 85 (470) Q Consensus 7 ivG~pNvGKStL~N~l~~~~~aiv~~~~g~Trd~~~~~~~~~~-~~~~liDT~G~~~~~~~~~~~~i~~~~~~ai~~aD~ 85 (470) T Consensus 1 ivG~~N~GKStL~N~L~~~~~~~vs~~~gtT~~~~~~~~~~~~~~~i~lvDtpG~~~~~~--~~~~~~~~~~~~~~~~D~ 78 (163) T cd00880 1 LFGRTNAGKSSLLNALLGQEVAIVSPVPGTTTDPVEYVWELGPLGPVVLIDTPGIDEAGG--LGREREELARRVLERADL 78 (163) T ss_pred CCCCCCCCHHHHHHHHHCCCCCEECCCCCEECCCEEEEEEECCCCEEEEEECCCCCCCCC--HHHHHHHHHHHHHHHCCE T ss_conf 919799899999999958996101698998656458999954786599972798522231--016899999999986898 Q ss_pred EEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHCCCHHHHHH-------HHHHHHCCCCCEEEHHHCCCCCHHHHHH Q ss_conf 999975988776234455533210233222205652230121001-------2455312222010011102220147999 Q gi|255764471|r 86 ILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQRNF-------YEIYSLDFKEIVEISAEHDLGTSELHSV 158 (470) Q Consensus 86 il~vvD~~~g~~~~D~~i~~~lr~~~~~~ilv~NK~D~~~~~~~~-------~e~~~lg~~~~i~iSA~~g~Gi~~L~~~ 158 (470) T Consensus 79 il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~~~~~~~~~~~~~~~~~~~~~~~i~~iSA~~g~gi~~L~~~ 158 (163) T cd00880 79 ILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLPEEEEEELLELRLLILLLLLGLPVIAVSALTGEGIDELREA 158 (163) T ss_pred EEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHH T ss_conf 99998789997556699999999719742788534206787899999999999987679985999978989799999999 Q ss_pred HHHH Q ss_conf 9998 Q gi|255764471|r 159 IFKI 162 (470) Q Consensus 159 i~~~ 162 (470) T Consensus 159 i~e~ 162 (163) T cd00880 159 LIEA 162 (163) T ss_pred HHHH T ss_conf 9951

HHsearch alignment for GI: 255764471 and conserved domain: cd00880