HHsearch alignment for GI: 255764471 and conserved domain: cd04123

>cd04123 Rab21 Rab21 subfamily. The localization and function of Rab21 are not clearly defined, with conflicting data reported. Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker. More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site
Probab=99.64  E-value=5.2e-16  Score=126.85  Aligned_cols=151  Identities=21%  Similarity=0.278  Sum_probs=95.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCC-CCEEEECCEE--EEEEECHHCCCCCCCCCHHHHHHCCCCC
Q ss_conf             038864035642567887652012110002456654202-3114203406--9998171104444430001110001210
Q gi|255764471|r  204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSV-SISWNWKNHP--IEIFDTAGMRKPSRITESLEQKTVKKSM  280 (470)
Q Consensus       204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i-~~~~~~~~~~--~~liDTaGirkk~~~~~~~E~~s~~~t~  280 (470)
T Consensus         1 ~Ki~vvG~~~vGKTsli~r~~~~~--f~~~~~~ti~~~~~~k~i~~~~~~~~l~iwDt~G~----------~~~~~~~-~   67 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLRYVENK--FNEKHESTTQASFFQKTVNIGGKRIDLAIWDTAGQ----------ERYHALG-P   67 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCC--CCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCC----------CCCCCCC-H
T ss_conf             989999999967999999998398--99876775264799999999999999999958997----------3035563-1


Q ss_pred             EEEECCEEEEEECCCCCCCHH--HHHHHHHHHH---CCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             012012059984553212202--1223200000---03576655894422335415556665420133320048831112
Q gi|255764471|r  281 QSVRTCETTIVLLDATIPFEK--QDLRIVDSVF---NTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINT  355 (470)
Q Consensus       281 ~~i~~advvi~viDa~~~~~~--qd~~i~~~i~---~~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~~~~~i~~  355 (470)
T Consensus        68 ~~~~~a~~~ilv~d~t~~~Sf~~i~~~-~~~i~~~~~~~~~iilvgnK~Dl~~~r~v~~~e~~~~a-~~----~~~~y~e  141 (162)
T cd04123          68 IYYRDADGAILVYDITDADSFQKVKKW-IKELKQMRGNNISLVIVGNKIDLERQRVVSKSEAEEYA-KS----VGAKHFE  141 (162)
T ss_pred             HHEECCCEEEEEEECCCHHHHHHHHHH-HHHHHHHCCCCCCEEEECCCCCCHHHCCCCHHHHHHHH-HH----CCCEEEE
T ss_conf             330114457999638998999999999-99999876999746866332132540888999999999-98----2998999


Q ss_pred             CCCCCCCCHHHHHHHHHH
Q ss_conf             345333485899999999
Q gi|255764471|r  356 ISGRTGEGLDDLMVSVLE  373 (470)
Q Consensus       356 iSA~~g~gi~~l~~~i~~  373 (470)
T Consensus       142 ~Sak~g~nV~e~F~~l~~  159 (162)
T cd04123         142 TSAKTGKGIEELFLSLAK  159 (162)
T ss_pred             EECCCCCCHHHHHHHHHH
T ss_conf             812788198999999999