HHsearch alignment for GI: 255764471 and conserved domain: cd04125

>cd04125 RabA_like RabA-like subfamily. RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells. The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression. The function of RabA remains unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.65  E-value=5.2e-16  Score=126.85  Aligned_cols=155  Identities=18%  Similarity=0.209  Sum_probs=89.9

Q ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCEE--EEEEECHHCCCCCCCCCHHHHHHCCCCCE
Q ss_conf             0388640356425678876520121100024566542023114203406--99981711044444300011100012100
Q gi|255764471|r  204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHP--IEIFDTAGMRKPSRITESLEQKTVKKSMQ  281 (470)
Q Consensus       204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~~~~~~--~~liDTaGirkk~~~~~~~E~~s~~~t~~  281 (470)
T Consensus         1 ~KivvvGd~~VGKTsli~r~~~~~f~-~~~~~Tig~~~~~k~i~~~~~~~~l~iwDtaG----------~e~~~~l~-~~   68 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKRFTEDEFS-ESTKSTIGVDFKIKTVYIENKIIKLQIWDTNG----------QERFRSLN-NS   68 (188)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCC-CCCCCCCCEEEEEEEEEECCEEEEEEEEECCC----------CHHHHHHH-HH
T ss_conf             97999999997899999999519689-98688654035799999999999999998999----------71045789-99


Q ss_pred             EEECCEEEEEECCCCCCCHHHHH-HHHHHHHC---CCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             12012059984553212202122-32000000---357665589442233541555666542013332004883111234
Q gi|255764471|r  282 SVRTCETTIVLLDATIPFEKQDL-RIVDSVFN---TGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTIS  357 (470)
Q Consensus       282 ~i~~advvi~viDa~~~~~~qd~-~i~~~i~~---~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~~~~~~~~~~~i~~iS  357 (470)
T Consensus        69 ~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~V~~~e~~-----~~a~~~~~~~~E~S  143 (188)
T cd04125          69 YYRGAHGYLLVYDVTDQESFENLKFWINEINRYARENVIKVIVANKSDLVNNKVVDSNIAK-----SFCDSLNIPFFETS  143 (188)
T ss_pred             HHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHCCCCCHHHHH-----HHHHHCCCEEEEEC
T ss_conf             8637867999803898789999999999999878986624510013447660679999999-----99998699899974


Q ss_pred             CCCCCCHHHHHHHHHHHH
Q ss_conf             533348589999999999
Q gi|255764471|r  358 GRTGEGLDDLMVSVLEIN  375 (470)
Q Consensus       358 A~~g~gi~~l~~~i~~~~  375 (470)
T Consensus       144 Aktg~nV~e~F~~l~~~i  161 (188)
T cd04125         144 AKQSINVEEAFILLVKLI  161 (188)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             788909899999999999