>cd04128 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are

Probab=99.67 E-value=1.9e-16 Score=129.71 Aligned_cols=155 Identities=12% Similarity=0.124 Sum_probs=95.4 Q ss_pred EEEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHH-HHCCCCEEEECCEEE--EEEECHHCCCCCCCCCHHHHHHCCCCC Q ss_conf 03886403564256788765201211000245665-420231142034069--998171104444430001110001210 Q gi|255764471|r 204 LRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGIT-RDSVSISWNWKNHPI--EIFDTAGMRKPSRITESLEQKTVKKSM 280 (470) Q Consensus 204 i~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtT-rD~i~~~~~~~~~~~--~liDTaGirkk~~~~~~~E~~s~~~t~ 280 (470) T Consensus 1 iKivlvGd~~VGKTsLi~rf~~~~F--~~~y~~Tig~d~~~k~i~v~~~~v~l~iwDtaG----------qe~f~~~~-~ 67 (182) T cd04128 1 LKIGLLGDAQIGKTSLMVKYVEGEF--DEDYIQTLGVNFMEKTISIRGTEITFSIWDLGG----------QREFINML-P 67 (182) T ss_pred CEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCCEEEEEEEEEEECCEEEEEEEEECCC----------CHHHHHHH-H T ss_conf 9899999999898999999953999--999888733898999999999999999986776----------48789999-9 Q ss_pred EEEECCEEEEEECCCCCCCHHH--HHHHHHHHHCCC--CCCCEEEECCCCCCCHHHH-HHHHHHHCCCCCCCCCCCCCCC Q ss_conf 0120120599845532122021--223200000035--7665589442233541555-6665420133320048831112 Q gi|255764471|r 281 QSVRTCETTIVLLDATIPFEKQ--DLRIVDSVFNTG--HAVVLALNKWDMVSDKLNL-LQDLRTKAIKNLPQIGDIYINT 355 (470) Q Consensus 281 ~~i~~advvi~viDa~~~~~~q--d~~i~~~i~~~~--k~~iiv~NK~Dli~~~~~~-~~~~~~~~~~~~~~~~~~~i~~ 355 (470) T Consensus 68 ~y~~~a~~~ilvfDit~~~Sf~~~~~w-~~~i~~~~~~~~~ilVGnK~DL~~~~~~~~~~~~~~-~~~~~a~~~~~~f~e 145 (182) T cd04128 68 LVCNDAVAILFMFDLTRKSTLNSIKEW-YRQARGFNKTAIPILVGTKYDLFADLPPEEQEEITK-QARKYAKAMKAPLIF 145 (182) T ss_pred HHHCCCCEEEEEEECCCHHHHHHHHHH-HHHHHHHCCCCCEEEEEECCCCCCCCCCHHEEHHHH-HHHHHHHHCCCEEEE T ss_conf 986478789999978998999989999-999997689998899998663556556223102489-999999984998999 Q ss_pred CCCCCCCCHHHHHHHHHH Q ss_conf 345333485899999999 Q gi|255764471|r 356 ISGRTGEGLDDLMVSVLE 373 (470) Q Consensus 356 iSA~~g~gi~~l~~~i~~ 373 (470) T Consensus 146 tSAk~~~nV~e~F~~i~~ 163 (182) T cd04128 146 CSTSHSINVQKIFKIVLA 163 (182) T ss_pred EECCCCCCHHHHHHHHHH T ss_conf 947999798999999999

HHsearch alignment for GI: 255764471 and conserved domain: cd04128