HHsearch alignment for GI: 255764471 and conserved domain: cd04151

>cd04151 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network. Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting. In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors. Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding. Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2. Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi. In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=99.61  E-value=3.5e-15  Score=121.27  Aligned_cols=145  Identities=23%  Similarity=0.260  Sum_probs=94.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             89997189887888999985885010258985302238999998998999996588420763689999999999999877
Q gi|255764471|r    4 TIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINEA   83 (470)
Q Consensus         4 ~iaivG~pNvGKStL~N~l~~~~~aiv~~~~g~Trd~~~~~~~~~~~~~~liDT~G~~~~~~~~~~~~i~~~~~~ai~~a   83 (470)
T Consensus         1 Kil~lG~~~~GKTsll~~~~~~~~--~~~~pTi--g~~~~~i~~~~~~~~iwD~~G~e~-----~r----~~~~~y~~~~   67 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQLGEV--VTTIPTI--GFNVETVTYKNLKFQVWDLGGQTS-----IR----PYWRCYYSNT   67 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHHCCCC--CCCCCCC--CCCEEEEEECCEEEEEEECCCCCC-----CC----HHHHHHCCCC
T ss_conf             999999999989999999970996--7757848--824699998988999996798624-----46----2788746678


Q ss_pred             CEEEEEECCCCCCC--HHHHHHHHHHH---CCCCCCCCCHHHHCCCHHH--HHHHHHHHH----C-CCCCEEEHHHCCCC
Q ss_conf             98999975988776--23445553321---0233222205652230121--001245531----2-22201001110222
Q gi|255764471|r   84 HLILFLIDSKAGIT--PYDHAITSFLR---KKNIPIIIVSNKMDTRIAQ--RNFYEIYSL----D-FKEIVEISAEHDLG  151 (470)
Q Consensus        84 D~il~vvD~~~g~~--~~D~~i~~~lr---~~~~~~ilv~NK~D~~~~~--~~~~e~~~l----g-~~~~i~iSA~~g~G  151 (470)
T Consensus        68 ~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~l~l~~~~~~~~~~~~tSA~tG~g  147 (158)
T cd04151          68 DAIIYVVDSTDRDRLGTAKEELHAMLEEEELKGAVLLVFANKQDMPGALSEAEISEKLGLSELKDRTWSIFKTSAIKGEG  147 (158)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             89999974578789999999999998346536981999997667765779999999985987416996899967878939


Q ss_pred             CHHHHHHHHH
Q ss_conf             0147999999
Q gi|255764471|r  152 TSELHSVIFK  161 (470)
Q Consensus       152 i~~L~~~i~~  161 (470)
T Consensus       148 V~e~f~wL~~  157 (158)
T cd04151         148 LDEGMDWLVN  157 (158)
T ss_pred             HHHHHHHHHC
T ss_conf             9999999856