>cd04154 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

Probab=99.77 E-value=3.5e-18 Score=141.50 Aligned_cols=146 Identities=19% Similarity=0.276 Sum_probs=101.5 Q ss_pred EEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 08999718988788899998588501025898530223899999899899999658842076368999999999999987 Q gi|255764471|r 3 YTIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSIAKQMNDQTELAINE 82 (470) Q Consensus 3 ~~iaivG~pNvGKStL~N~l~~~~~aiv~~~~g~Trd~~~~~~~~~~~~~~liDT~G~~~~~~~~~~~~i~~~~~~ai~~ 82 (470) T Consensus 15 ~KililG~~~sGKTsll~~l~~~~~~~~~pT~G~~----~~~~~~~~~~l~iwD~~G~e~-----~~----~~~~~y~~~ 81 (173) T cd04154 15 MRILILGLDNAGKTTILKKLLGEDIDTISPTLGFQ----IKTLEYEGYKLNIWDVGGQKT-----LR----PYWRNYFES 81 (173) T ss_pred EEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCEE----EEEEEECCEEEEEEECCCCCC-----CC----HHHHHHHCC T ss_conf 18999989997889999998399989726705777----899998999999996688602-----00----589997226 Q ss_pred CCEEEEEECCCCCCC--HHHHHHHHHHH---CCCCCCCCCHHHHCCCHHH--HHHHHHHHH-CCC----CCEEEHHHCCC Q ss_conf 798999975988776--23445553321---0233222205652230121--001245531-222----20100111022 Q gi|255764471|r 83 AHLILFLIDSKAGIT--PYDHAITSFLR---KKNIPIIIVSNKMDTRIAQ--RNFYEIYSL-DFK----EIVEISAEHDL 150 (470) Q Consensus 83 aD~il~vvD~~~g~~--~~D~~i~~~lr---~~~~~~ilv~NK~D~~~~~--~~~~e~~~l-g~~----~~i~iSA~~g~ 150 (470) T Consensus 82 a~~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~~~~~SAktG~ 161 (173) T cd04154 82 TDALIWVVDSSDRLRLDDCKRELKELLQEERLAGATLLILANKQDLPGALSEEEIREALELDKISSHHWRIQPCSAVTGE 161 (173) T ss_pred CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCC T ss_conf 65389998556578899999999999863541598479998765677788999999998687445798299998896692 Q ss_pred CCHHHHHHHHH Q ss_conf 20147999999 Q gi|255764471|r 151 GTSELHSVIFK 161 (470) Q Consensus 151 Gi~~L~~~i~~ 161 (470) T Consensus 162 gI~e~f~wL~~ 172 (173) T cd04154 162 GLLQGIDWLVD 172 (173) T ss_pred CHHHHHHHHHC T ss_conf 98999999864

HHsearch alignment for GI: 255764471 and conserved domain: cd04154