>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

Probab=99.63 E-value=2.5e-15 Score=122.21 Aligned_cols=151 Identities=15% Similarity=0.170 Sum_probs=56.9 Q ss_pred EEEEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCEEEEEEECHHCCCCCCCCCHHHHHHCCCCCEEEE Q ss_conf 38864035642567887652012110002456654202311420340699981711044444300011100012100120 Q gi|255764471|r 205 RIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVR 284 (470) Q Consensus 205 ~~~~~G~pN~GKStl~N~l~~~~r~ivs~~~GtTrD~i~~~~~~~~~~~~liDTaGirkk~~~~~~~E~~s~~~t~~~i~ 284 (470) T Consensus 1 KIlilGl~~sGKTtil~~l~~~~~~~~~pT~G~~----~~~i~~~~~~l~iwD~gG~----------~~~r~~-w~~Yy~ 65 (169) T cd04158 1 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFN----VETVEYKNLKFTIWDVGGK----------HKLRPL-WKHYYL 65 (169) T ss_pred CEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCC----EEEEEECCEEEEEEECCCC----------CCCCHH-HHHHCC T ss_conf 9999998999889999999579968977868816----6999989889999989997----------244636-787555 Q ss_pred CCEEEEEECCCCCCCHHHH--HHH---HHHHHCCCCCCCEEEECCCCCCCHHHHHHHHHHHCC-CCCCCCCCCCCCCCCC Q ss_conf 1205998455321220212--232---000000357665589442233541555666542013-3320048831112345 Q gi|255764471|r 285 TCETTIVLLDATIPFEKQD--LRI---VDSVFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAI-KNLPQIGDIYINTISG 358 (470) Q Consensus 285 ~advvi~viDa~~~~~~qd--~~i---~~~i~~~~k~~iiv~NK~Dli~~~~~~~~~~~~~~~-~~~~~~~~~~i~~iSA 358 (470) T Consensus 66 ~~~~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK~Dl~~~~--~~~ei~~~l~l~~~~~~~~~~i~~~SA 143 (169) T cd04158 66 NTQAVVFVVDSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQDVAGAL--SVEEMTELLSLHKLCCGRSWYIQGCDA 143 (169) T ss_pred CCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC--CHHHHHHHHCCHHHCCCCCEEEEEEEC T ss_conf 762799999863067799999999999712753798499997355677798--999999985705452699629995557 Q ss_pred CCCCCHHHHHHHHH Q ss_conf 33348589999999 Q gi|255764471|r 359 RTGEGLDDLMVSVL 372 (470) Q Consensus 359 ~~g~gi~~l~~~i~ 372 (470) T Consensus 144 ~tG~Gi~e~~~WL~ 157 (169) T cd04158 144 RSGMGLYEGLDWLS 157 (169) T ss_pred CCCCCHHHHHHHHH T ss_conf 27959899999999

HHsearch alignment for GI: 255764471 and conserved domain: cd04158