RPSBLAST alignment for GI: 255764471 and conserved domain: TIGR00437

>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB. FeoB (773 amino acids in E. coli), a cytoplasmic membrane protein required for iron(II) update, is encoded in an operon with FeoA (75 amino acids), which is also required, and is regulated by Fur. There appear to be two copies in Archaeoglobus fulgidus and Clostridium acetobutylicum. Length = 591
 Score = 62.8 bits (153), Expect = 2e-10
 Identities = 48/175 (27%), Positives = 72/175 (41%), Gaps = 11/175 (6%)

Query: 9   GAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAGIADGKNCSI 68
           G PNVGKSTLFN L       VGN PG+T ++  G+    G    IVD  GI      S+
Sbjct: 1   GNPNVGKSTLFNALTGAN-QTVGNWPGVTVEKKEGKLGFQGEDIEIVDLPGIYSLTTFSL 59

Query: 69  AKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMDTRIAQR 128
            +++  +  L   +  L++ ++D+       +  +T  L +  IP+I+  N +D   A++
Sbjct: 60  EEEVA-RDYLLNEKPDLVVNVVDASN--LERNLYLTLQLLELGIPMILALNLVD--EAEK 114

Query: 129 NFYEIYSLDFKEI-----VEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENN 178
               I     +E      V  SA    G   L   I K    K        I   
Sbjct: 115 KGIRIDEEKLEERLGVPVVPTSATEGRGIERLKDAIRKAIGLKELKKRAIEIVPE 169