RPSBLAST alignment for GI: 255764471 and conserved domain: PRK00089

>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed. Length = 292
 Score = 87.4 bits (218), Expect = 7e-18
 Identities = 53/179 (29%), Positives = 81/179 (45%), Gaps = 39/179 (21%)

Query: 206 IAVVGRPNVGKSTLINRLLGY-------------NRLLTGSQSGI-TRDSVSISWNWKNH 251
           +A+VGRPNVGKSTL+N L+G              +R+      GI T D   I       
Sbjct: 8   VAIVGRPNVGKSTLLNALVGQKISIVSPKPQTTRHRIR-----GIVTEDDAQI------- 55

Query: 252 PIEIF-DTAGMRKP-SRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDS 309
              IF DT G+ KP   +  ++  K    S++ V   +  + ++DA       D  I++ 
Sbjct: 56  ---IFVDTPGIHKPKRALNRAM-NKAAWSSLKDV---DLVLFVVDADEKIGPGDEFILEK 108

Query: 310 VFNTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLM 368
           +      V+L LNK D+V DK  LL     + +  L    +I    IS   G+ +D+L+
Sbjct: 109 LKKVKTPVILVLNKIDLVKDKEELLP--LLEELSELMDFAEIV--PISALKGDNVDELL 163