RPSBLAST alignment for GI: 255764471 and conserved domain: PRK03003

>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed. Length = 472
 Score =  282 bits (723), Expect = 2e-76
 Identities = 153/467 (32%), Positives = 230/467 (49%), Gaps = 58/467 (12%)

Query: 4   TIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFNIVDTAG-IAD 62
            +A+VG PNVGKSTL NR++ ++ AVV + PG+TRDR+   A  NG  F +VDT G   D
Sbjct: 40  VVAVVGRPNVGKSTLVNRILGRREAVVEDVPGVTRDRVSYDAEWNGRRFTVVDTGGWEPD 99

Query: 63  GKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIVSNKMD 122
            K   +   + +Q E+A+  A  +LF++D+  G T  D A+   LR+   P+I+ +NK+D
Sbjct: 100 AK--GLQASVAEQAEVAMRTADAVLFVVDATVGATATDEAVARVLRRSGKPVILAANKVD 157

Query: 123 TRIAQRNFYEIYSLDFKEIVEISAEHDLGTSELHSVIFKIFKQKYPNHPLEMIENNKRNE 182
               + +   ++SL   E   +SA H  G  +L   +        P              
Sbjct: 158 DERGEADAAALWSLGLGEPHPVSALHGRGVGDLLDAVLAAL----P-------------- 199

Query: 183 ESPKENITSEGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSV 242
           E P+    S G         P R+A+VG+PNVGKS+L+N+L G  R +    +G T D V
Sbjct: 200 EVPRVGSASGG---------PRRVALVGKPNVGKSSLLNKLAGEERSVVDDVAGTTVDPV 250

Query: 243 SISWNWKNHPIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRT------CETTIVLLDAT 296
                         DTAG+R+  +     E         S+RT       E  +VL+DA+
Sbjct: 251 DSLIELGGKTWRFVDTAGLRRRVKQASGHE------YYASLRTHAAIEAAEVAVVLIDAS 304

Query: 297 IPFEKQDLRIVDSVFNTGHAVVLALNKWDMV-SDKLNLL-----QDLRTKAIKNLPQIGD 350
            P  +QD R++  V   G A+VLA NKWD+V  D+   L     ++L    +   P++  
Sbjct: 305 EPISEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYYLEREIDRELAQ--VPWAPRV-- 360

Query: 351 IYINTISGRTGEGLDDLMVSVLEINKLWKTRITTSYLNSWLQKTQLQNPPPTIFNRYNRL 410
                IS +TG  +D L+ ++    + W TRI T  LN+WL +     PPP    +  R+
Sbjct: 361 ----NISAKTGRAVDKLVPALETALESWDTRIPTGRLNAWLGELVAATPPPVRGGKQPRI 416

Query: 411 KYITQIQSSPPSFLIFCTFPNKIPESYKRYLINRLRINFSLSGIPIR 457
            + TQ  + PP+F++F T    +   Y+R+L  RLR  F   G PIR
Sbjct: 417 LFATQASTRPPTFVLFTT--GFLEAGYRRFLERRLRETFGFEGSPIR 461