Query gi|255764475|ref|YP_003084341.1| hypothetical protein CLIBASIA_03592 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 59 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 23785 Date Mon May 30 12:23:37 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 255764475.hhm -d /home/congqian_1/database/pdb/pdb70.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 2k8s_A Thioredoxin; dimer, str 20.0 22 0.00093 16.4 0.5 15 2-16 53-67 (80) 2 3or1_C Sulfite reductase GAMA; 14.1 70 0.0029 13.7 2.3 17 38-54 46-62 (105) 3 1ji8_A Dissimilatory siroheme- 13.7 45 0.0019 14.8 0.8 17 37-53 51-67 (111) 4 1cnt_1 CNTF, ciliary neurotrop 13.1 75 0.0032 13.5 1.8 16 43-58 154-171 (187) 5 16vp_A Protein (VP16, VMW65, A 11.8 82 0.0035 13.3 2.2 16 41-56 122-137 (366) 6 1yx3_A Hypothetical protein DS 10.8 89 0.0038 13.1 2.3 17 37-53 65-81 (132) 7 2oxl_A Hypothetical protein YM 10.3 93 0.0039 13.0 1.7 14 31-44 24-37 (64) 8 2kyg_A CAMP-dependent protein 9.7 98 0.0041 12.9 1.8 22 19-53 6-27 (50) 9 1sau_A Sulfite reductase, desu 9.5 1E+02 0.0042 12.8 2.3 16 38-53 50-65 (115) 10 2izy_A CAMP-dependent protein 9.3 1E+02 0.0043 12.8 1.8 11 43-53 12-22 (54) No 1 >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Probab=19.99 E-value=22 Score=16.45 Aligned_cols=15 Identities=47% Similarity=0.698 Sum_probs=11.1 Q ss_pred CCCCCCCCCCCEEEE Q ss_conf 532231057600031 Q gi|255764475|r 2 VKSIPAIVPNTAILQ 16 (59) Q Consensus 2 vksipaivpntailq 16 (59) |||.||.|-|...+. T Consensus 53 VkSVPALV~~G~vlH 67 (80) T 2k8s_A 53 VKSVPALVIDGAAFH 67 (80) T ss_dssp CCEEEEEEETTEEEE T ss_pred CCCCCEEEECCCEEE T ss_conf 742566998795899 No 2 >3or1_C Sulfite reductase GAMA; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_C* 2v4j_C* Probab=14.12 E-value=70 Score=13.69 Aligned_cols=17 Identities=29% Similarity=0.335 Sum_probs=14.4 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999999988789998 Q gi|255764475|r 38 LWLIITLLRGYCREYII 54 (59) Q Consensus 38 lwliitllrgycreyii 54 (59) -|-+|..+|.|-.+|-. T Consensus 46 Hw~vI~~lR~~y~~~~~ 62 (105) T 3or1_C 46 HQKIIDFLQDYYKANGI 62 (105) T ss_dssp HHHHHHHHHHHHHHHSS T ss_pred HHHHHHHHHHHHHHHCC T ss_conf 99999999999999589 No 3 >1ji8_A Dissimilatory siroheme-sulfite reductase; orthogonal helical bundle, structural genomics, PSI, protein structure initiative; NMR {Pyrobaculum aerophilum} SCOP: d.203.1.1 Probab=13.70 E-value=45 Score=14.76 Aligned_cols=17 Identities=24% Similarity=0.571 Sum_probs=14.2 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999999998878999 Q gi|255764475|r 37 ILWLIITLLRGYCREYI 53 (59) Q Consensus 37 ilwliitllrgycreyi 53 (59) --|-||..+|.|-+||- T Consensus 51 ~HW~vI~~lR~~y~e~~ 67 (111) T 1ji8_A 51 EHWKLVKYLREYWETFG 67 (111) T ss_dssp HHHHHHHHHHHHTTTTS T ss_pred HHHHHHHHHHHHHHHHC T ss_conf 99999999999999978 No 4 >1cnt_1 CNTF, ciliary neurotrophic factor; cytokine, growth factor; 2.40A {Homo sapiens} SCOP: a.26.1.1 Probab=13.07 E-value=75 Score=13.52 Aligned_cols=16 Identities=25% Similarity=0.270 Sum_probs=12.1 Q ss_pred HHHHHH--HHHHHHHHHC Q ss_conf 999988--7899987642 Q gi|255764475|r 43 TLLRGY--CREYIIFLSR 58 (59) Q Consensus 43 tllrgy--creyiiflsr 58 (59) -.+||| ||||..+++| T Consensus 154 ~Kl~G~~Vlrel~~w~~r 171 (187) T 1cnt_1 154 KKLWGLKVLQELSQWTVR 171 (187) T ss_dssp HHHHHHHHHHHHHHHHHH T ss_pred HHHHHHHHHHHHHHHHHH T ss_conf 997332469999999999 No 5 >16vp_A Protein (VP16, VMW65, ATIF); transcriptional regulatory protein; 2.10A {Human herpesvirus 1} SCOP: d.180.1.1 Probab=11.82 E-value=82 Score=13.29 Aligned_cols=16 Identities=25% Similarity=0.571 Sum_probs=11.8 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999998878999876 Q gi|255764475|r 41 IITLLRGYCREYIIFL 56 (59) Q Consensus 41 iitllrgycreyiifl 56 (59) --+||.||||.-+-+| T Consensus 122 Y~~LL~~YCrAL~~YL 137 (366) T 16vp_A 122 YRTVLANFCSALYRYL 137 (366) T ss_dssp HHHHHHHHHHHHHHHH T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9999999999999999 No 6 >1yx3_A Hypothetical protein DSRC; structural genomics, dissimilatory sulfite reductase, gamma subunit, DSVC, PSI, protein structure initiative; NMR {Allochromatium vinosum} Probab=10.81 E-value=89 Score=13.10 Aligned_cols=17 Identities=47% Similarity=0.808 Sum_probs=14.3 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99999999998878999 Q gi|255764475|r 37 ILWLIITLLRGYCREYI 53 (59) Q Consensus 37 ilwliitllrgycreyi 53 (59) --|-+|.++|.|-.+|- T Consensus 65 ~HW~VI~~lR~~Y~e~~ 81 (132) T 1yx3_A 65 EHWDIINFLREYYEEYQ 81 (132) T ss_dssp HHHHHHHHHHHHHHHHC T ss_pred HHHHHHHHHHHHHHHHC T ss_conf 99999999999999978 No 7 >2oxl_A Hypothetical protein YMGB; bacterial protein, biofilm, acid resistance, DNA binding protein, dimer, gene regulation; HET: BOG; 1.80A {Escherichia coli} Probab=10.30 E-value=93 Score=13.00 Aligned_cols=14 Identities=50% Similarity=0.477 Sum_probs=10.2 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 88769999999999 Q gi|255764475|r 31 VAMPAIILWLIITL 44 (59) Q Consensus 31 vampaiilwliitl 44 (59) |.--+||+|||-.| T Consensus 24 vtNKaIIl~LI~~L 37 (64) T 2oxl_A 24 VNNKNIILSLIHSL 37 (64) T ss_dssp CSHHHHHHHHHHHH T ss_pred CCHHHHHHHHHHHH T ss_conf 76799999999998 No 8 >2kyg_A CAMP-dependent protein kinase type II-alpha regul subunit; protein/protein, homodimer bound to monomer, protein binding; NMR {Homo sapiens} Probab=9.71 E-value=98 Score=12.87 Aligned_cols=22 Identities=36% Similarity=0.575 Sum_probs=13.5 Q ss_pred CEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 53897047721788769999999999998878999 Q gi|255764475|r 19 NVQISIPFPMPIVAMPAIILWLIITLLRGYCREYI 53 (59) Q Consensus 19 nvqisipfpmpivampaiilwliitllrgycreyi 53 (59) +-||.||--.| .+|++|+||.+ T Consensus 6 ~~~i~IP~gl~-------------~lL~~ftreVL 27 (50) T 2kyg_A 6 MSHIQIPPGLT-------------ELLQGYTVEVL 27 (50) T ss_dssp TCCCCCCTTHH-------------HHHHHHHHHHH T ss_pred CCCCCCCCCHH-------------HHHHHHHHHHH T ss_conf 22367996569-------------99999999999 No 9 >1sau_A Sulfite reductase, desulfoviridin-type subunit gamma; orthogonal helical bundle, oxidoreductase; 1.12A {Archaeoglobus fulgidus dsm 4304} PDB: 2a5w_A Probab=9.55 E-value=1e+02 Score=12.84 Aligned_cols=16 Identities=44% Similarity=0.748 Sum_probs=13.9 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999998878999 Q gi|255764475|r 38 LWLIITLLRGYCREYI 53 (59) Q Consensus 38 lwliitllrgycreyi 53 (59) -|-+|..+|.|-++|- T Consensus 50 Hw~vI~~lR~~y~~~~ 65 (115) T 1sau_A 50 HWKIIRYLRDYFIKYG 65 (115) T ss_dssp HHHHHHHHHHHHHHHS T ss_pred HHHHHHHHHHHHHHHC T ss_conf 9999999999999968 No 10 >2izy_A CAMP-dependent protein kinase regulatory subunit II; D/D, RII, PKA, acetylation, transferase, CAMP- binding, phosphorylation, nucleotide-binding; 2.2A {Mus musculus} SCOP: a.31.1.1 PDB: 1l6e_A 1r2a_A 2drn_A 2h9r_A Probab=9.28 E-value=1e+02 Score=12.78 Aligned_cols=11 Identities=45% Similarity=0.806 Sum_probs=0.0 Q ss_pred HHHHHHHHHHH Q ss_conf 99998878999 Q gi|255764475|r 43 TLLRGYCREYI 53 (59) Q Consensus 43 tllrgycreyi 53 (59) .+|++|+||.+ T Consensus 12 ~lL~~ftreVL 22 (54) T 2izy_A 12 ELLQGYTVEVL 22 (54) T ss_dssp HHHHHHHHHHH T ss_pred HHHHHHHHHHH T ss_conf 99999999999 Done!