HHsearch alignment for GI: 255764476 and conserved domain: TIGR01059
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA . Type II topoisomerases are ATP-dependent enzymes, and can be subdivided according to their structure and reaction mechanisms: type IIA (topoisomerase II or gyrase, and topoisomerase IV) and type IIB (topoisomerase VI). These enzymes are responsible for relaxing supercoiled DNA as well as for introducing both negative and positive supercoils . Topoisomerase II (called gyrase in bacteria) primarily introduces negative supercoils into DNA. In bacteria, topoisomerase II consists of two polypeptide subunits, gyrA and gyrB, which form a heterotetramer: (BA)2. In most eukaryotes, topoisomerase II consists of a single polypeptide, where the N- and C-terminal regions correspond to gyrB and gyrA, respectively. This entry represents the B subunit (gyrB) as found predominantly in bacteria, but does not include the topoisomerase II enzymes composed of a single polypeptide, as are found in most eukaryotes. GyrB has two functional domains: an N-terminal ATPase and a C-terminal responsible for subunit interactions, the latter differing between subunit B and single polypeptide topoisomerase II . More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003918 DNA topoisomerase (ATP-hydrolyzing) activity, 0005524 ATP binding, 0006265 DNA topological change, 0005694 chromosome.
Probab=93.71 E-value=0.051 Score=31.73 Aligned_cols=51 Identities=16% Similarity=0.176 Sum_probs=29.9
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf 9988889999999999999999999966663225899999999973577788
Q gi|255764476|r 550 RAERALTEKNEALRKADEIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGS 601 (792)
Q Consensus 550 ~~E~aL~e~~eale~a~~lk~~F~~~vSHELrtPLt~I~G~a~lL~~~~~g~ 601 (792)
T Consensus 588 L~~~~Le~~~~~~~~~~k~~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 638 (818)
T TIGR01059 588 LVGELLEDLVNAYLELEKRKN-LINRLERKAIRFSEELLIYQDLLEKELLEY 638 (818)
T ss_pred HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCCHHHHHHHHHHHCHHHHCH
T ss_conf 999999999999998863144-799998740435578887555302222001