>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase. They subsequently transfer the phosphoryl group to the Asp acceptor residue of a response regulator protein. Two-component signalling systems, consisting of a histidine protein kinase that senses a signal input and a response regulator that mediates the output, are ancient and evolutionarily conserved signaling mechanisms in prokaryotes and eukaryotes.

Probab=99.05 E-value=6.1e-10 Score=85.95 Aligned_cols=63 Identities=43% Similarity=0.637 Sum_probs=56.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99999999666632258999999999735777889989999999999999999999999999988 Q gi|255764476|r 568 IKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNSKQSQYVEYISASSTILLNLVNDILDLAT 632 (792) Q Consensus 568 lk~~F~~~vSHELrtPLt~I~G~a~lL~~~~~g~l~~~q~e~~~~I~~s~~~l~~li~diLdls~ 632 (792) T Consensus 3 ~~~~~~a~iaHelrtPL~~i~~~~~~l~~~~~--~~~~~~~~~~~i~~~~~~l~~lv~~~l~~~~ 65 (65) T cd00082 3 AKGEFLANVSHELRTPLTAIRGALELLEEELL--DDEEQREYLERIREEAERLLRLINDLLDLSR 65 (65) T ss_pred HHHHHHHHHHHHHCCHHHHHHCCHHHHHHCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 59999998729870488888601489885668--8699999999999999999999999998609

HHsearch alignment for GI: 255764476 and conserved domain: cd00082