BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764477|ref|YP_003065232.2| dephospho-CoA kinase [Candidatus Liberibacter asiaticus str. psy62] (199 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764477|ref|YP_003065232.2| dephospho-CoA kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 401 bits (1030), Expect = e-114, Method: Compositional matrix adjust. Identities = 199/199 (100%), Positives = 199/199 (100%) Query: 1 MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKV 60 MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKV Sbjct: 1 MLIIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAVDIIKKTFPRSIQNNKV 60 Query: 61 NKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEY 120 NKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEY Sbjct: 61 NKARLLGILQKSPAKLEILEKIVHPMVRMHEKKILHDLSCRGEKIVFFDTPLLFEKRKEY 120 Query: 121 LFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAI 180 LFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAI Sbjct: 121 LFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMNEKDKISRADYVINTEGTIEAI 180 Query: 181 EKETQKMLKYILKINDSKK 199 EKETQKMLKYILKINDSKK Sbjct: 181 EKETQKMLKYILKINDSKK 199 >gi|254780827|ref|YP_003065240.1| pantothenate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 31.2 bits (69), Expect = 0.013, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 8/67 (11%) Query: 2 LIIGLTGSIGTGKTTVAEFL-------KKEKIPVISSDDIVDKLYHYEAVDII-KKTFPR 53 ++G+TGS+ GK+T A L K+ +I++D + A +++ +K FP Sbjct: 84 FVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143 Query: 54 SIQNNKV 60 S +NK+ Sbjct: 144 SYDSNKL 150 >gi|254781225|ref|YP_003065638.1| P4 family phage/plasmid primase [Candidatus Liberibacter asiaticus str. psy62] Length = 789 Score = 26.2 bits (56), Expect = 0.39, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 20/41 (48%) Query: 109 DTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEEN 149 DTPLL E+ EYLF +T ++ ++ K T N Sbjct: 161 DTPLLSEEDVEYLFKFFQEITVPLVKDKKSIIPSKTWTNNN 201 >gi|254781047|ref|YP_003065460.1| AFG1-family ATPase [Candidatus Liberibacter asiaticus str. psy62] Length = 404 Score = 25.8 bits (55), Expect = 0.59, Method: Compositional matrix adjust. Identities = 14/60 (23%), Positives = 36/60 (60%) Query: 97 DLSCRGEKIVFFDTPLLFEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSK 156 +++ R + ++ D PLL E RK+++ ++++ +E + ++S +++ E+ F + L K Sbjct: 294 EIANRFDVVIINDIPLLKEDRKDWIKRFIMLIDVFYEHKIGLIISSEENIEDLFPYKLRK 353 >gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 503 Score = 25.0 bits (53), Expect = 0.84, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 2 LIIGLTGSIGTGKTTVAEFLKKEKI 26 + IG++ SIG K ++ FL++E + Sbjct: 227 MAIGVSYSIGKSKGSITHFLRRESL 251 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 25.0 bits (53), Expect = 1.0, Method: Compositional matrix adjust. Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 7/87 (8%) Query: 114 FEKRKEYLFDAVVVVTCSFETQRERVLSRKKHTEENFLFILSKQMN-----EKD-KISRA 167 F + +YL D F +L K T NFLF +K+ EKD I R Sbjct: 271 FHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKDLAIPRF 330 Query: 168 DYVINTEGTIEAIEKETQKMLKYILKI 194 + +I+ G I K ++ Y + Sbjct: 331 EMLID-WGWFYFIAKPMFMLMSYFYNL 356 >gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Score = 24.3 bits (51), Expect = 1.4, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 3 IIGLTGSIGTGKTTVAEFLKKEKIP 27 I+G+ G G GKTT+ L ++ P Sbjct: 345 IVGVIGPNGAGKTTLFRMLTGDESP 369 >gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 24.3 bits (51), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Query: 3 IIGLTGSIGTGKTTVAEFLKKEKIPVISSDDIVDKLYHYEAV 44 ++ + G G+GK+T++ L K I++ DI LY E++ Sbjct: 31 VVAIMGPNGSGKSTLSYLLSGHKDYEITAGDI---LYKGESI 69 >gi|254780146|ref|YP_003064559.1| 50S ribosomal protein L1 [Candidatus Liberibacter asiaticus str. psy62] Length = 232 Score = 23.9 bits (50), Expect = 2.0, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 144 KHTEENFLFILSKQMNEKDKISRADYV 170 K EEN L +S + K +++ DYV Sbjct: 184 KKIEENVLAFVSAVVKAKPSVAKGDYV 210 >gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 28 VISSDDIVDKLYHYEAVDIIKKTFPRSIQNN 58 ++S++ V KL+ Y DI++K F ++ N Sbjct: 474 ILSTNRAVSKLFGYPVEDILRKPFTVFLEQN 504 >gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 23.5 bits (49), Expect = 2.4, Method: Compositional matrix adjust. Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 3 IIGLTGSIGTGKTTVAEFLKKEKIPVISS 31 I+ L G G+GK+T+A+ + P I S Sbjct: 38 IVTLIGPNGSGKSTIAKLITGIIKPTIGS 66 >gi|255764490|ref|YP_003065085.2| dehydrogenase, E1 component [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 3 IIGLTGSIGTGKTTVAEFLKKEKIPVIS-SDDIVDKLYHYEAVDI 46 I+G S+GTG ++ + +KI V+ D ++ YE+ +I Sbjct: 159 IVGAQVSLGTGIAFANKYRRSDKICVVCFGDGAANQGQVYESFNI 203 >gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 104 KIVFFDTPLLFEKRKEY 120 +IVF DTP +F + Y Sbjct: 71 QIVFLDTPGIFNAKDSY 87 >gi|254780689|ref|YP_003065102.1| flagellar motor switch protein G [Candidatus Liberibacter asiaticus str. psy62] Length = 345 Score = 23.1 bits (48), Expect = 3.5, Method: Compositional matrix adjust. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 76 LEILEKIVHPMVRMHEKKILHDLSCRGEKIV 106 LE+L K +H + ILH LS R KI+ Sbjct: 272 LEVLGKALHGTSIETQNAILHCLSNRQRKII 302 >gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Score = 23.1 bits (48), Expect = 3.9, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 4 IGLTGSIGTGKTTVAEFL 21 IG+ G G GKTT+ + L Sbjct: 313 IGIVGPNGAGKTTLLKLL 330 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 22.7 bits (47), Expect = 4.7, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 3 IIGLTGSIGTGKTTV 17 I+GL G G+GK+T+ Sbjct: 45 IVGLLGRSGSGKSTL 59 >gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 22.3 bits (46), Expect = 5.4, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query: 142 RKKHTEENFLFILSKQMNEKDKISRADYVINTE-GTIEAIEKETQKMLK 189 R+K + FL +S+ M EKD++++A + + T+ A+ + T + K Sbjct: 331 REKLSTTEFLSRVSQWMKEKDRLTQALTLAQSRITTLSALPQMTDFLFK 379 >gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 22.3 bits (46), Expect = 5.4, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 36 DKLYHYEAVDIIKKTFPRSIQNNKVNKARLLGI 68 ++L HY +I K P ++QN + + +GI Sbjct: 79 NRLQHYYQFQVIIKPNPLNLQNLYIESLKAVGI 111 >gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 22.3 bits (46), Expect = 5.8, Method: Compositional matrix adjust. Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 3 IIGLTGSIGTGKTT 16 I+GL G G GKTT Sbjct: 53 IVGLLGPNGAGKTT 66 >gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Score = 21.9 bits (45), Expect = 6.9, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 4 IGLTGSIGTGKTTVAEFLKKEKIPVISSDDIV--DKLY 39 I + G+ GK+T+ L K+K+ V+ + + D+LY Sbjct: 5 IAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLY 42 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 21.9 bits (45), Expect = 7.7, Method: Compositional matrix adjust. Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Query: 3 IIGLTGSIGTGKTTVAEFLKKEKIP----VISSDDIVDKL 38 I+ L GTGK+T+ ++P VI ++ + +KL Sbjct: 38 IVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKL 77 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 130,183 Number of Sequences: 1233 Number of extensions: 5461 Number of successful extensions: 43 Number of sequences better than 100.0: 24 Number of HSP's better than 100.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 26 length of query: 199 length of database: 328,796 effective HSP length: 70 effective length of query: 129 effective length of database: 242,486 effective search space: 31280694 effective search space used: 31280694 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)