HHsearch alignment for GI: 255764482 and conserved domain: COG0500

>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only].
Probab=97.34  E-value=0.0037  Score=37.00  Aligned_cols=103  Identities=20%  Similarity=0.212  Sum_probs=62.0

Q ss_pred             EEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCC-CCCC
Q ss_conf             999587843899999986799-88999988989999889999980664522253020044423531000012357-6520
Q gi|255764482|r   15 LADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKN-NFYD   92 (225)
Q Consensus        15 VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~-~~fD   92 (225)
T Consensus        52 ~ld~~~g~g~~~-~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~-~~~~~---~~~~~~~~~~~-----~~~~~~~~~~d  121 (257)
T COG0500          52 VLDIGCGTGRLA-LLARLGGRGAYVVGVDLSPEMLALARARAEG-AGLGL---VDFVVADALGG-----VLPFEDSASFD  121 (257)
T ss_pred             EEEEECCCCHHH-HHHHHHCCCCEEEEECCCHHHHHHHHHHHCC-CCCCC---EEEEECCCCCC-----CCCCCCCCEEE
T ss_conf             588603854689-9999735785799936888999999986300-45663---57676042135-----56756666577


Q ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             577226544644654788545565205668989999999986246983787028
Q gi|255764482|r   93 HVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR  146 (225)
Q Consensus        93 lii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~  146 (225)
T Consensus       122 ~~~~~~~~~~~----------------~---~~~~~~~~~~~l~~~g~~~~~~~  156 (257)
T COG0500         122 LVISLLVLHLL----------------P---PAKALRELLRVLKPGGRLVLSDL  156 (257)
T ss_pred             EEEECCHHHHH----------------H---HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             89861234430----------------2---89999999987078868999962