HHsearch alignment for GI: 255764482 and conserved domain: COG1889

>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis].
Probab=96.20  E-value=0.083  Score=29.41  Aligned_cols=136  Identities=18%  Similarity=0.143  Sum_probs=80.6

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
T Consensus        72 ~pi~~g~~VLYLGAasGTTvSHVSDIv~~G~iYaVEfs~R~~reLl~~a~------~R~Ni~PIL~DA~~P~~Y~~----  141 (231)
T COG1889          72 FPIKEGSKVLYLGAASGTTVSHVSDIVGEGRIYAVEFSPRPMRELLDVAE------KRPNIIPILEDARKPEKYRH----  141 (231)
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHCCCCCCEEEEEECCHHHHHHHHHHH------HCCCCEEEECCCCCCHHHHH----
T ss_conf             77699987899503679857677760478708999964446999999987------47874002013688377653----


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCH----------HHHHHHH-H
Q ss_conf             5765205772265446446547885455652056689899999999862469837870288----------8899999-9
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARP----------QSLIQIV-N  155 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~----------~~l~~~l-~  155 (225)
T Consensus       142 ~Ve~VDviy~D--------VAQp~------------Qa~I~~~Na~~FLk~~G~~~i~iKArSIdvT~dp~~vf~~ev~k  201 (231)
T COG1889         142 LVEKVDVIYQD--------VAQPN------------QAEILADNAEFFLKKGGYVVIAIKARSIDVTADPEEVFKDEVEK  201 (231)
T ss_pred             HCCCCCEEEEE--------CCCCH------------HHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             12454389983--------68810------------78999988997321697399999851230458989999999999


Q ss_pred             HHHCCCCCEEEEEECCC
Q ss_conf             85217884699981458
Q gi|255764482|r  156 ACARRIGSLEITPLHPR  172 (225)
Q Consensus       156 ~~~~~~~~~~i~~v~~~  172 (225)
T Consensus       202 L~~~~f~i~e~~~LePy  218 (231)
T COG1889         202 LEEGGFEILEVVDLEPY  218 (231)
T ss_pred             HHHCCCEEEEEECCCCC
T ss_conf             98569504677636776