HHsearch alignment for GI: 255764482 and conserved domain: COG2226

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].
Probab=99.71  E-value=2.1e-16  Score=111.80  Aligned_cols=112  Identities=17%  Similarity=0.266  Sum_probs=90.3

Q ss_pred             HHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             24389985578999587843899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    4 ASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         4 a~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
T Consensus        44 i~~~~~~~g~~vLDva~GTGd~a~~~~k~~g~g~v~~~D~s~~ML~~a~~k~~~~~~~---~-i~fv~~dAe~LP-----  114 (238)
T COG2226          44 ISLLGIKPGDKVLDVACGTGDMALLLAKSVGTGEVVGLDISESMLEVAREKLKKKGVQ---N-VEFVVGDAENLP-----  114 (238)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHCCCCC---C-EEEEEECHHHCC-----
T ss_conf             9860789998799966873199999999658844999979999999999874324766---3-279970565498-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             1235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       115 --f~D~sFD~vt~~fgl------------------rnv~d~~~aL~E~~RVlKpgG~~~vl  155 (238)
T COG2226         115 --FPDNSFDAVTISFGL------------------RNVTDIDKALKEMYRVLKPGGRLLVL  155 (238)
T ss_pred             --CCCCCCCEEEEEEHH------------------HCCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             --888765889865123------------------52787899999998762687499998