HHsearch alignment for GI: 255764482 and conserved domain: COG3129

>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only].
Probab=98.92  E-value=2.6e-10  Score=77.43  Aligned_cols=89  Identities=20%  Similarity=0.215  Sum_probs=66.6

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200-44423531000012357
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGENRNLAGLKN   88 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~~~~~~~~~   88 (225)
T Consensus        77 ~~~i~~LDIGvGAnCIYPliG~~eYgwrfvGseid~~sl~sAk~ii~~N~--~l~~~I~lr~qk~~~~---if~giig~n  151 (292)
T COG3129          77 GKNIRILDIGVGANCIYPLIGVHEYGWRFVGSEIDSQSLSSAKAIISANP--GLERAIRLRRQKDSDA---IFNGIIGKN  151 (292)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCEEECCEEECCCCCHHHHHHHHHHHHCCC--CHHHHEEEEECCCCCC---CCCCCCCCC
T ss_conf             67647885045764200213321212200157468778888899987090--4153336775268543---416510344


Q ss_pred             CCCCEEEECCCCCCC
Q ss_conf             652057722654464
Q gi|255764482|r   89 NFYDHVIMNPPFNER  103 (225)
Q Consensus        89 ~~fDlii~nPPy~~~  103 (225)
T Consensus       152 E~yd~tlCNPPFh~s  166 (292)
T COG3129         152 ERYDATLCNPPFHDS  166 (292)
T ss_pred             CEEEEEECCCCCCHH
T ss_conf             333057518983020