HHsearch alignment for GI: 255764482 and conserved domain: COG4076

>COG4076 Predicted RNA methylase [General function prediction only].
Probab=98.58  E-value=1.1e-07  Score=62.51  Aligned_cols=100  Identities=21%  Similarity=0.275  Sum_probs=74.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
T Consensus        33 ~d~~~DLGaGsGiLs~~Aa~~--A~rViAiE~dPk~a~~a~eN~~v~g~~n----~evv~gDA~~y~f---------e~A   97 (252)
T COG4076          33 EDTFADLGAGSGILSVVAAHA--AERVIAIEKDPKRARLAEENLHVPGDVN----WEVVVGDARDYDF---------ENA   97 (252)
T ss_pred             HHCEEECCCCCCHHHHHHHHH--HCEEEEEECCCHHHHHHHHCCCCCCCCC----EEEEECCCCCCCC---------CCC
T ss_conf             410563468863288988753--2027887418078777650577788764----6898055321332---------345


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEE
Q ss_conf             057722654464465478854556520566898999999998624698378
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLS  142 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~  142 (225)
T Consensus        98 DvvicEml----------------DTaLi~E~qVpV~n~vleFLr~d~tii  132 (252)
T COG4076          98 DVVICEML----------------DTALIEEKQVPVINAVLEFLRYDPTII  132 (252)
T ss_pred             CEEHHHHH----------------HHHHHCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             34087776----------------677633421289999999863388252