HHsearch alignment for GI: 255764482 and conserved domain: COG4106

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only].
Probab=99.76  E-value=3.2e-18  Score=122.06  Aligned_cols=177  Identities=20%  Similarity=0.216  Sum_probs=122.7

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
T Consensus        22 Lla~Vp~~~~~~v~DLGCGpGnsTelL~~RwP~A~i~GiDsS~~Mla~Aa~rl---------p~~~f~~aDl~~w~----   88 (257)
T COG4106          22 LLARVPLERPRRVVDLGCGPGNSTELLARRWPDAVITGIDSSPAMLAKAAQRL---------PDATFEEADLRTWK----   88 (257)
T ss_pred             HHHHCCCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHC---------CCCCEECCCHHHCC----
T ss_conf             98647866641034557788778899998688886760469999999999748---------99732105275449----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC----------------
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787028----------------
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR----------------  146 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~----------------  146 (225)
T Consensus        89 ----p~~~~dllfaNAvlqWlp------------------dH~~ll~rL~~~L~Pgg~LAVQmPdN~depsH~~mr~~A~  146 (257)
T COG4106          89 ----PEQPTDLLFANAVLQWLP------------------DHPELLPRLVSQLAPGGVLAVQMPDNLDEPSHRLMRETAD  146 (257)
T ss_pred             ----CCCCCCHHHHHHHHHHCC------------------CCHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             ----987633033443664436------------------4089999999850888569997887647645799999874


Q ss_pred             --------------------HHHHHHHHHHHHCCCCCEEEEEECCCCCCCCEEEEEEEEECCCCCCE-EECCEEEECCCC
Q ss_conf             --------------------88899999985217884699981458969830999999977888747-707568983887
Q gi|255764482|r  147 --------------------PQSLIQIVNACARRIGSLEITPLHPREGECASRILVTGRKGMRGQLR-FRYPIVLHKPNG  205 (225)
Q Consensus       147 --------------------~~~l~~~l~~~~~~~~~~~i~~v~~~~~~~~~~vlv~~~k~~~~~~~-~~~~l~l~~~~g  205 (225)
T Consensus       147 ~~p~~~~l~~~~~~r~~v~s~a~Yy~lLa~~~~rvDiW~T~Y~h~l~~a~a---IvdWvkgT--gLrP~L~~L--~e~~~  219 (257)
T COG4106         147 EAPFAQELGGRGLTRAPLPSPAAYYELLAPLACRVDIWHTTYYHQLPGADA---IVDWVKGT--GLRPYLDRL--DEEER  219 (257)
T ss_pred             CCCHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCEEEEEEEECCCCCCCCCC---HHHHEECC--CCCEECCCC--CHHHH
T ss_conf             283666627665446778998999998576543255454123433798632---22110024--542002015--98999


Q ss_pred             CHHHHHHHHHHCCCCC
Q ss_conf             4001899999738763
Q gi|255764482|r  206 QPYSRFVTDLINGKRS  221 (225)
Q Consensus       206 ~~yt~~~~~l~~~~~~  221 (225)
T Consensus       220 ~~FL~~Y~~~l~~aYP  235 (257)
T COG4106         220 QRFLDRYLALLAEAYP  235 (257)
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999997688