HHsearch alignment for GI: 255764482 and conserved domain: COG4122

>COG4122 Predicted O-methyltransferase [General function prediction only].
Probab=99.35  E-value=7.5e-12  Score=86.10  Aligned_cols=112  Identities=23%  Similarity=0.350  Sum_probs=88.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEEC-CCCCCCCCC
Q ss_conf             62438998557899958784389999998679-9889999889899998899999806645222530200-444235310
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIE-VDVTLVGEN   80 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~-~D~~~~~~~   80 (225)
T Consensus        51 L~~L~~~~~~k~iLEiGT~~GySal~mA~~l~~~g~l~tiE~~~e~~~~A~~n~~~ag---~~~~i~~~~~gdal~~l~~  127 (219)
T COG4122          51 LRLLARLSGPKRILEIGTAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAG---VDDRIELLLGGDALDVLSR  127 (219)
T ss_pred             HHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCCHHHHHHH
T ss_conf             9999973498649996352379999999638889769997079899999999999759---7652898835747999973


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
T Consensus       128 -----~~~~~fDliFID---------------------adK~~yp~~le~~~~lLr~GGliv~  164 (219)
T COG4122         128 -----LLDGSFDLVFID---------------------ADKADYPEYLERALPLLRPGGLIVA  164 (219)
T ss_pred             -----CCCCCCCEEEEE---------------------CCHHHCHHHHHHHHHHHCCCCEEEE
T ss_conf             -----347885689983---------------------7843599999999997378968998