HHsearch alignment for GI: 255764482 and conserved domain: KOG0022

>KOG0022 consensus.
Probab=93.93  E-value=0.21  Score=27.12  Aligned_cols=49  Identities=14%  Similarity=0.184  Sum_probs=39.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHH-CCCCEEEEEECCHHHHHHHHH
Q ss_conf             4389985578999587843899999986-799889999889899998899
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASR-LHEAQILLAERSPLMAHYARK   53 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r-~~~~~v~gvD~~~~~~~~A~~   53 (225)
T Consensus       186 ~~Akv~~GstvAVfGLG~VGLav~~Gaka~GAsrIIgvDiN~~Kf~~ak~  235 (375)
T KOG0022         186 NTAKVEPGSTVAVFGLGGVGLAVAMGAKAAGASRIIGVDINPDKFEKAKE  235 (375)
T ss_pred             HHCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHH
T ss_conf             21346779879999054578899876776186517998558789899876