HHsearch alignment for GI: 255764482 and conserved domain: KOG0822

>KOG0822 consensus.
Probab=93.88  E-value=0.21  Score=27.15  Aligned_cols=104  Identities=14%  Similarity=0.115  Sum_probs=68.4

Q ss_pred             CCCEEEEECCCHHHHHHH---HHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             557899958784389999---99867-99889999889899998899999806645222530200444235310000123
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLA---VASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~---la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
T Consensus       367 ~~tVimvlGaGRGPLv~~~lkaa~~~~RkVklyavEKNPNAivtL~~-~---n~~~W~~~Vtii~~DMR~w~a-------  435 (649)
T KOG0822         367 TTTVIMVLGAGRGPLVDASLKAAEETDRKVKLYAVEKNPNAIVTLQN-R---NFECWDNRVTIISSDMRKWNA-------  435 (649)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHH-H---CHHHHCCEEEEEECCCCCCCC-------
T ss_conf             32899996388760788999999872471579999338544042454-2---436546816999343124688-------


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEE
Q ss_conf             5765205772265446446547885455652056689899999999862469837
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQL  141 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~  141 (225)
T Consensus       436 p~eq~DI~VSELLGS----------------FGDNELSPECLDG~q~fLkpdgIs  474 (649)
T KOG0822         436 PREQADIIVSELLGS----------------FGDNELSPECLDGAQKFLKPDGIS  474 (649)
T ss_pred             CHHHCCCHHHHHHCC----------------CCCCCCCHHHHHHHHHHCCCCCEE
T ss_conf             444212039976422----------------467667977877788515888557