HHsearch alignment for GI: 255764482 and conserved domain: KOG1099

>KOG1099 consensus.
Probab=97.26  E-value=0.00036  Score=42.76  Aligned_cols=116  Identities=15%  Similarity=0.216  Sum_probs=69.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHCCC------C---EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             78999587843899999986799------8---89999889899998899999806645222530200444235310000
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRLHE------A---QILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~~~------~---~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
T Consensus        43 ~rvVDLCAAPGSWSQvlSrkL~~~~~~~~~~~~kIVaVDLQ~MaP--------I-------~GV~qlq~DIT~~stae~I  107 (294)
T KOG1099          43 KRVVDLCAAPGSWSQVLSRKLYKPLPSSGERDKKIVAVDLQPMAP--------I-------EGVIQLQGDITSASTAEAI  107 (294)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHCCCCCCCHHHCCEEEEECCCCCC--------C-------CCEEEEECCCCCHHHHHHH
T ss_conf             677435308983999999997324887420116279985565776--------6-------7627850455777689999


Q ss_pred             CCCCC-CCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHH
Q ss_conf             12357-6520577226544644654788545565205668989999999986246983787-0288889
Q gi|255764482|r   84 AGLKN-NFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSL  150 (225)
Q Consensus        84 ~~~~~-~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l  150 (225)
T Consensus       108 i~hfggekAdlVvcDGAP-DvTGlHd~DEy~-Q-----~qLllaAl~i~t~Vlk~Gg~FVaKifRg~~t  169 (294)
T KOG1099         108 IEHFGGEKADLVVCDGAP-DVTGLHDLDEYV-Q-----AQLLLAALNIATCVLKPGGSFVAKIFRGRDT  169 (294)
T ss_pred             HHHHCCCCCCEEEECCCC-CCCCCCCHHHHH-H-----HHHHHHHHHHHHHEECCCCEEEHHHHCCCCH
T ss_conf             998579976678847998-744532088999-9-----9999999877742014787525546426750