HHsearch alignment for GI: 255764482 and conserved domain: KOG1271

>KOG1271 consensus.
Probab=99.20  E-value=1.3e-10  Score=79.00  Aligned_cols=129  Identities=14%  Similarity=0.202  Sum_probs=87.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             57899958784389999998679988999988989999889999980664522253020044423531000012357652
Q gi|255764482|r   12 SFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNFY   91 (225)
Q Consensus        12 ~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~f   91 (225)
T Consensus        68 A~~VlDLGtGNG~~L~~L~~egf~~~L~GvDYs~~AV~LA~niAe~~~---~~n~I~f~q~DI~~~~-------~~~~qf  137 (227)
T KOG1271          68 ADRVLDLGTGNGHLLFQLAKEGFQSKLTGVDYSEKAVELAQNIAERDG---FSNEIRFQQLDITDPD-------FLSGQF  137 (227)
T ss_pred             CCCEEECCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCCCEEEEEEECCCCC-------CCCCCE
T ss_conf             321166157961889998871388886453157889999987887527---8853168873225775-------555432


Q ss_pred             CEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCC
Q ss_conf             057722654464465478854556520566898999999998624698378702888899999985217
Q gi|255764482|r   92 DHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARR  160 (225)
Q Consensus        92 Dlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~~~~~  160 (225)
T Consensus       138 dlvlDKGT~DAi--sLs~d~~--------~~r~~~Y~d~v~~ll~~~gifvItSCN~T~dELv~~f~~~  196 (227)
T KOG1271         138 DLVLDKGTLDAI--SLSPDGP--------VGRLVVYLDSVEKLLSPGGIFVITSCNFTKDELVEEFENF  196 (227)
T ss_pred             EEEEECCCEEEE--ECCCCCC--------CCCEEEEHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHCC
T ss_conf             389605741225--5077776--------6543443556863038896799985576589999997259