HHsearch alignment for GI: 255764482 and conserved domain: KOG1500

>KOG1500 consensus.
Probab=98.94  E-value=6.4e-09  Score=69.56  Aligned_cols=104  Identities=23%  Similarity=0.251  Sum_probs=77.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
T Consensus       177 ~~kiVlDVGaGSGILS~FAaqA-GA~~vYAvEAS-~MAqyA~~Lv~~N---~~~~rItVI~GKiEdieL--------PEk  243 (517)
T KOG1500         177 QDKIVLDVGAGSGILSFFAAQA-GAKKVYAVEAS-EMAQYARKLVASN---NLADRITVIPGKIEDIEL--------PEK  243 (517)
T ss_pred             CCCEEEEECCCCCHHHHHHHHH-CCCEEEEEEHH-HHHHHHHHHHHCC---CCCCEEEECCCCCCEECC--------CCC
T ss_conf             7748998158824899999873-86538987456-7999999987436---632037870563201037--------510


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             20577226544644654788545565205668989999999986246983787
Q gi|255764482|r   91 YDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        91 fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
T Consensus       244 ~DviISEPMG~mL-----~NER----------MLE-sYl~Ark~l~P~GkMfP  280 (517)
T KOG1500         244 VDVIISEPMGYML-----VNER----------MLE-SYLHARKWLKPNGKMFP  280 (517)
T ss_pred             CCEEEECCCHHHH-----HHHH----------HHH-HHHHHHHHCCCCCCCCC
T ss_conf             3478725621411-----1088----------899-99999874287774467