HHsearch alignment for GI: 255764482 and conserved domain: KOG1663

>KOG1663 consensus.
Probab=98.88  E-value=1.2e-08  Score=68.01  Aligned_cols=117  Identities=18%  Similarity=0.268  Sum_probs=90.8

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             662438998557899958784389999998679-9889999889899998899999806645222530200444235310
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
T Consensus        64 fl~~li~~~~ak~~lelGvfTGySaL~~Alalp~dGrv~a~eid~~~~~~~~~~~k~ag---v~~KI~~i~g~a~esLd~  140 (237)
T KOG1663          64 FLQMLIRLLNAKRTLELGVFTGYSALAVALALPEDGRVVAIEIDADAYEIGLELVKLAG---VDHKITFIEGPALESLDE  140 (237)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCEEEEEECCHHHHHHH
T ss_conf             99999998587338998121278999999745999659999618688887599998606---330342342525666999


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             000123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   81 RNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        81 ~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
T Consensus       141 l-~~~~~~~tfDfaFvDa---------------------dK~nY~~y~e~~l~Llr~GGvi~~  181 (237)
T KOG1663         141 L-LADGESGTFDFAFVDA---------------------DKDNYSNYYERLLRLLRVGGVIVV  181 (237)
T ss_pred             H-HHCCCCCCEEEEEECC---------------------CHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             9-8557998425999736---------------------667789999999856213538999