HHsearch alignment for GI: 255764482 and conserved domain: KOG2198

>KOG2198 consensus.
Probab=98.74  E-value=1.4e-07  Score=61.95  Aligned_cols=152  Identities=13%  Similarity=0.119  Sum_probs=96.4

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCC----CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             438998557899958784389999998679----9889999889899998899999806645222530200444235310
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLH----EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGEN   80 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~----~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~   80 (225)
T Consensus       149 L~L~v~p~~~VLDmCAAPG~Kt~qLLeal~~~~~~g~vvaND~d~~R~~~L~~q~~~l~----~~~~~v~~~~~~~~p~~  224 (375)
T KOG2198         149 LALGVKPGDKVLDMCAAPGGKTAQLLEALHKDPTRGYVVANDVDPKRLNMLVHQLKRLP----SPNLLVTNHDASLFPNI  224 (375)
T ss_pred             HHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHCCC----CCCEEEECCCCEECCCC
T ss_conf             20226799844420138984489999997237777736753457889999999985269----84333431211005641


Q ss_pred             C--CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHH-HH----CCCCCCHHHHHHHHHHHCCCCCEEEEE----CCHHH
Q ss_conf             0--0012357652057722654464465478854556-52----056689899999999862469837870----28888
Q gi|255764482|r   81 R--NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEE-AH----VMLEDSFEKWIRTACAIMRSSGQLSLI----ARPQS  149 (225)
Q Consensus        81 ~--~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~-a~----~~~~~~~~~~~~~a~~lLkpgG~~~~i----~~~~~  149 (225)
T Consensus       225 ~~~~~~~~~~~~fDrVLvDVPCS~Dgt~rk~~~i~~~~w~~~~~~~L~~LQ~~iL~rgl~lLk~GG~lVYSTCSLnpieN  304 (375)
T KOG2198         225 YLKDGNDKEQLKFDRVLVDVPCSGDGTLRKNPNIWKEGWKTQRALGLHALQLRILRRGLRLLKVGGRLVYSTCSLNPIEN  304 (375)
T ss_pred             CCCCCCHHHHHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHH
T ss_conf             01467603344125368714568984302280276665554113597389999999999872578779994257872002


Q ss_pred             H---HHHHHHHHCC
Q ss_conf             9---9999985217
Q gi|255764482|r  150 L---IQIVNACARR  160 (225)
Q Consensus       150 l---~~~l~~~~~~  160 (225)
T Consensus       305 EaVV~~~L~~~~~~  318 (375)
T KOG2198         305 EAVVQEALQKVGGA  318 (375)
T ss_pred             HHHHHHHHHHHCCC
T ss_conf             79999999983685