HHsearch alignment for GI: 255764482 and conserved domain: KOG2361

>KOG2361 consensus.
Probab=98.90  E-value=2.4e-08  Score=66.31  Aligned_cols=111  Identities=12%  Similarity=0.178  Sum_probs=77.7

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC--CEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799--8899998898999988999998066452225302004442353100001235
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE--AQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~--~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
T Consensus        70 ~~~~~ilEvGCGvGNtvfPll~~~~n~~l~v~acDfsp~Ai~~vk~~~~~~e-----~~~~afv~Dlt~~~---~~~~~~  141 (264)
T KOG2361          70 KSAETILEVGCGVGNTVFPLLKTSPNNRLKVYACDFSPRAIELVKKSSGYDE-----SRVEAFVWDLTSPS---LKEPPE  141 (264)
T ss_pred             CCHHHHEEECCCCCCCCCHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCCCH-----HHHCCCCEECCCHH---CCCCCC
T ss_conf             5734511222477751224442489987389974898689999873633264-----55012000165601---037888


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       142 ~~svD~it~IFvLSA---i-------------~pek~~~a~~nl~~llKPGG~llfr  182 (264)
T KOG2361         142 EGSVDIITLIFVLSA---I-------------HPEKMQSVIKNLRTLLKPGGSLLFR  182 (264)
T ss_pred             CCCCCEEEEEEEEEC---C-------------CHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             676334789998751---4-------------8477899999999974888679984