HHsearch alignment for GI: 255764482 and conserved domain: KOG2730

>KOG2730 consensus.
Probab=98.68  E-value=1.4e-08  Score=67.62  Aligned_cols=87  Identities=18%  Similarity=0.256  Sum_probs=70.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
T Consensus        94 ~~~~iidaf~g~gGntiqfa~~--~~~VisIdiDPikIa~AkhNaeiYG---I~~rItFI~GD~ld~~~~lq~~K---~~  165 (263)
T KOG2730          94 NAEVIVDAFCGVGGNTIQFALQ--GPYVIAIDIDPVKIACARHNAEVYG---VPDRITFICGDFLDLASKLKADK---IK  165 (263)
T ss_pred             CCCHHHHHHHCCCCHHHHHHHH--CCEEEEEECCHHHHHHHHCCCEEEC---CCCEEEEEECHHHHHHHHHHHHH---HE
T ss_conf             7430025453688428899871--8807998526788887760650325---77505888330999999886410---10


Q ss_pred             CCEEEECCCCCCCCC
Q ss_conf             205772265446446
Q gi|255764482|r   91 YDHVIMNPPFNERIG  105 (225)
Q Consensus        91 fDlii~nPPy~~~~~  105 (225)
T Consensus       166 ~~~vf~sppwggp~y  180 (263)
T KOG2730         166 YDCVFLSPPWGGPSY  180 (263)
T ss_pred             EEEEECCCCCCCCCH
T ss_conf             456616999999631