HHsearch alignment for GI: 255764482 and conserved domain: KOG3191

>KOG3191 consensus.
Probab=99.50  E-value=1.7e-12  Score=89.75  Aligned_cols=138  Identities=18%  Similarity=0.210  Sum_probs=103.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             55789995878438999999867-99889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   11 GSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        11 ~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
T Consensus        43 ~~~i~lEIG~GSGvvstfL~~~i~~~~~~latDiNp~A~~~Tl~TA~~n~~~-----~~~V~tdl~~~l--------~~~  109 (209)
T KOG3191          43 NPEICLEIGCGSGVVSTFLASVIGPQALYLATDINPEALEATLETARCNRVH-----IDVVRTDLLSGL--------RNE  109 (209)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCC-----CCEEEHHHHHHH--------CCC
T ss_conf             8605899348846599999974177716999549989998879999855775-----205652577663--------327


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCC---CHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHCCC
Q ss_conf             520577226544644654788545565205668---98999999998624698378702-8888999999852178
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLED---SFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACARRI  161 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~---~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~~~  161 (225)
T Consensus       110 ~VDvLvfNPPYVpt~~~~i~~~~i~~a~aGG~~Gr~v~d~ll~~v~~iLSp~Gv~Ylv~~~~N~p~ei~k~l~~~g  185 (209)
T KOG3191         110 SVDVLVFNPPYVPTSDEEIGDEGIASAWAGGKDGREVTDRLLPQVPDILSPRGVFYLVALRANKPKEILKILEKKG  185 (209)
T ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCHHHHHHHHHHCC
T ss_conf             7308997899676985442067788887457541789998876404442867437763013059799999874336