HHsearch alignment for GI: 255764482 and conserved domain: KOG4174

>KOG4174 consensus.
Probab=91.35  E-value=0.99  Score=23.33  Aligned_cols=129  Identities=16%  Similarity=0.175  Sum_probs=77.4

Q ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHCC--CCEEEEEECCHHHHH------HHHHHHHHHCCCCCCCCCEEECCCCCCCCC
Q ss_conf             998557899958784389999998679--988999988989999------889999980664522253020044423531
Q gi|255764482|r    8 NATGSFHLADLGAGAGAAGLAVASRLH--EAQILLAERSPLMAH------YARKTLALPANAQISKRISLIEVDVTLVGE   79 (225)
Q Consensus         8 ~~~~~~~VLDlGcG~G~~~l~la~r~~--~~~v~gvD~~~~~~~------~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~   79 (225)
T Consensus        53 ~~s~~~~ill~gEgdFSfs~sl~~~~g~sa~ni~atSlDsk~~dl~~KY~~~~~nv~~Lk~lG~---~I~h~Vdv~sl~~  129 (282)
T KOG4174          53 PYSKKQKILLVGEGDFSFSLSLAPHFGRSAGNITATSLDSKEFDLKQKYPDAKENVEALKRLGG---TILHGVDVTSLKF  129 (282)
T ss_pred             ECCCCCCEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHCCCCHHHHHHHHHHCCC---CEEECCCCEEEEE
T ss_conf             0466353799626632567888987474444245420010233420226664889999998199---2572013425773


Q ss_pred             CCCCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCC-CCCEEEEEC
Q ss_conf             000012357652057722654464465478854556520566898999999998624-698378702
Q gi|255764482|r   80 NRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMR-SSGQLSLIA  145 (225)
Q Consensus        80 ~~~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLk-pgG~~~~i~  145 (225)
T Consensus       130 ~~---~~~~~~~d~IiFNFPH~G~g~-~-~e~d~~-~i~~~qkL~rgFle~akemL~~edGeI~itl  190 (282)
T KOG4174         130 HA---DLRLQRYDNIIFNFPHSGKGI-K-FEQDRN-IIPLHQKLFRGFLESAKEMLKDEDGEIHITL  190 (282)
T ss_pred             CC---CCCCCCCCEEEECCCCCCCCC-C-CCCCHH-HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             32---013451015898178788775-4-211137-7899999999999999998773278289986