HHsearch alignment for GI: 255764482 and conserved domain: PRK00107

>PRK00107 gidB glucose-inhibited division protein B; Reviewed.
Probab=99.04  E-value=3.4e-08  Score=65.48  Aligned_cols=150  Identities=15%  Similarity=0.205  Sum_probs=100.4

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
T Consensus        61 ~~~~~~~~~~~~vlDiGSGaGfPGiplAI~~p~~~~~Lves~~KK~~FL~~~~~~L~L~n----v~v~~~R~E~~~----  132 (216)
T PRK00107         61 LLPYLQGEKPIRVLDVGSGAGFPGIPLAIARPDLQVTLVDSLGKKIAFLRQVAAELGLKN----VTVVHGRAEEFG----  132 (216)
T ss_pred             HHHHCCCCCCCEEEECCCCCCCHHHHHHHHCCCCCEEEECHHHHHHHHHHHHHHHCCCCC----EEEEEHHHHCCC----
T ss_conf             987337665877997079999426789997787729997387699999999999769998----799863544046----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH---HHC
Q ss_conf             01235765205772265446446547885455652056689899999999862469837870288889999998---521
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNA---CAR  159 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~~~~l~~~l~~---~~~  159 (225)
T Consensus       133 ----~~~~fD~itsR----------------------Ava~l~~l~~~~~~~l~~~g~~i~~KG~~~~~Ei~~a~~~~~~  186 (216)
T PRK00107        133 ----QEEKFDVVTSR----------------------AVASLSDLVELCLPLLKPGGRFLALKGQDPEEEIAELPKAIKK  186 (216)
T ss_pred             ----CCCCCCEEEEE----------------------HHHCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             ----56786689860----------------------5406999999999754889799998799959999998989998


Q ss_pred             -CCCCEEEEEECCCCCCCCEEEEEEEEEC
Q ss_conf             -7884699981458969830999999977
Q gi|255764482|r  160 -RIGSLEITPLHPREGECASRILVTGRKG  187 (225)
Q Consensus       160 -~~~~~~i~~v~~~~~~~~~~vlv~~~k~  187 (225)
T Consensus       187 ~~~~~~~~~~-~~lp~~~~~R~iv~i~k~  214 (216)
T PRK00107        187 LGGKVESVIE-LKVPGLDGERHLVVIKKK  214 (216)
T ss_pred             CCCEEEEEEE-EECCCCCCEEEEEEEEEC
T ss_conf             3975999999-988999873899999955