HHsearch alignment for GI: 255764482 and conserved domain: PRK00216

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed.
Probab=99.79  E-value=1.7e-18  Score=123.53  Aligned_cols=114  Identities=17%  Similarity=0.280  Sum_probs=91.5

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679-98899998898999988999998066452225302004442353100
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLH-EAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~-~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
T Consensus        43 ~v~~l~~~~g~~vLDvgcGTG~~~~~l~~~~~~~~~v~g~D~S~~ML~~A~~k~~~~~---~~~~i~~~~~da~~lp---  116 (239)
T PRK00216         43 TIKWLGVRPGDKVLDLACGTGDLAIALAKAVGETGEVVGLDFSEGMLAVGREKLLDKG---LSGNVEFVQGDAEALP---  116 (239)
T ss_pred             HHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCC---CCCCCEEEEECCCCCC---
T ss_conf             9986278999989884577638799999972997679999198899999999999738---9888507982355688---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             001235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       117 ----f~d~sfD~v~~~f~l~~------------------~~d~~~~l~E~~RVLkPGG~l~il  157 (239)
T PRK00216        117 ----FPDNSFDAVTIAFGLRN------------------VPDIDKALREMYRVLKPGGRLVIL  157 (239)
T ss_pred             ----CCCCCCCCCCCCCEEEE------------------CCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             ----87666765002615671------------------486799999999876648089999