HHsearch alignment for GI: 255764482 and conserved domain: PRK00377

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional.
Probab=99.60  E-value=1.3e-13  Score=95.99  Aligned_cols=133  Identities=17%  Similarity=0.164  Sum_probs=96.5

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
T Consensus        34 ~~L~l~~~~~vwDIGaGsGsvsiEaa~~~~~~~~V~aIE~~~e~~~~~~~N~~kfg~---~~nv~~i~G~ap~~l~~---  107 (198)
T PRK00377         34 SKLRLFKGGKLVDVGCGTGSVSVEAALIVGEGGKVYAIDKDELAVELTKKNAEKFGV---GDNVVLIEGEAPEVLPK---  107 (198)
T ss_pred             HHHCCCCCCEEEEECCCEEHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCC---CCCEEEEECCHHHHHHC---
T ss_conf             970999989999917703299999999669787599996788899999999998099---98859995254887720---


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCC
Q ss_conf             123576520577226544644654788545565205668989999999986246983787-0288889999998521788
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIG  162 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~  162 (225)
T Consensus       108 ---l~p~pD~vFI------G---------------G~~g~l~~il~~~~~~L~~gGriVinaVtlet~~~~~~~l~~~~~  163 (198)
T PRK00377        108 ---LNPKSDRYFI------G---------------GGGEELPEIIQAALEKIGKGGRIVADAILLESLNKALSALEELGY  163 (198)
T ss_pred             ---CCCCCCEEEE------E---------------CCCCCHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             ---8998898999------7---------------887778999999998579998999983629889999999997699


Q ss_pred             CEEEE
Q ss_conf             46999
Q gi|255764482|r  163 SLEIT  167 (225)
Q Consensus       163 ~~~i~  167 (225)
T Consensus       164 ~~ev~  168 (198)
T PRK00377        164 KYEVT  168 (198)
T ss_pred             CCEEE
T ss_conf             81499