HHsearch alignment for GI: 255764482 and conserved domain: PRK03612

>PRK03612 spermidine synthase; Provisional.
Probab=98.66  E-value=3.5e-07  Score=59.73  Aligned_cols=130  Identities=18%  Similarity=0.199  Sum_probs=90.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHH---HHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799-8899998898999988999---9980664522253020044423531000012
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHE-AQILLAERSPLMAHYARKT---LALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~-~~v~gvD~~~~~~~~A~~n---~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
T Consensus       292 ~~p~~VLiiGGGdG~a~revL-k~~~ve~v~lVelD~~vv~lar~~~~l~~~n~~a~~DpRv~v~~~Da~~~l~~-----  365 (516)
T PRK03612        292 PRARRVLILGGGDGLALREVL-KYPDVEQVTLVDLDPAVTELARTSPALRALNGGALDDPRVTVVNDDAFNWLRK-----  365 (516)
T ss_pred             CCCCEEEEECCCCCHHHHHHH-CCCCCCEEEEEECCHHHHHHHHHCCCHHHHHCCCCCCCCEEEEEHHHHHHHHH-----
T ss_conf             997738998377608799986-48996637899518899999985721444412323499648985378999986-----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-----CCHHHHHHHHHHHHC
Q ss_conf             35765205772265446446547885455652056689899999999862469837870-----288889999998521
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-----ARPQSLIQIVNACAR  159 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-----~~~~~l~~~l~~~~~  159 (225)
T Consensus       366 -~~~~yDvIi~D~pd----------P~~~---~~~~LYs~eFY~~~~~~L~~~G~~v~qs~Sp~~~~~~f~~i~~T~~~  430 (516)
T PRK03612        366 -LPETFDAIIVDLPD----------PSNP---ALGKLYSVEFYRLLKRRLAPDGLLVVQSTSPYFAPKAFWSIEATLEA  430 (516)
T ss_pred             -CCCCCCEEEEECCC----------CCCC---CCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             -88878889981899----------7995---22467539999999984499958999368975522034689999998