HHsearch alignment for GI: 255764482 and conserved domain: PRK04266

>PRK04266 fibrillarin; Provisional.
Probab=98.06  E-value=0.00055  Score=41.69  Aligned_cols=139  Identities=18%  Similarity=0.150  Sum_probs=87.2

Q ss_pred             HCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCC
Q ss_conf             38998557899958784389999998679988999988989999889999980664522253020044423531000012
Q gi|255764482|r    6 LVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAG   85 (225)
Q Consensus         6 ~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~   85 (225)
T Consensus        67 ~~~i~~gskVLYLGAasGTTVSHvsDiV~~G~VyAVE~spr~~RdL~~la~------~R~NivPIl~DAr~P~~Y~~~--  138 (226)
T PRK04266         67 NFPIKKGSKVLYLGAASGTTVSHVSDIVEEGRVYAVEFAPRVMRELLLVAE------ERKNIIPILGDARKPEEYAHL--  138 (226)
T ss_pred             CCCCCCCCEEEEECCCCCCCHHHHHHHCCCCEEEEEEECCHHHHHHHHHHH------HCCCCEEEECCCCCHHHHHHH--
T ss_conf             567589987999547779848889875179649999827077899999985------089962575467884564420--


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEECC----------HHHHHHHHH
Q ss_conf             3576520577226544644654788545565205668989999999986246983787028----------888999999
Q gi|255764482|r   86 LKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIAR----------PQSLIQIVN  155 (225)
Q Consensus        86 ~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~~----------~~~l~~~l~  155 (225)
T Consensus       139 --v~~VD~i~qDvA--------Q~d------------Qa~I~~~Na~~FLk~gG~~~l~iKA~Sid~t~~p~~vf~~~~~  196 (226)
T PRK04266        139 --VEKVDVIYQDVA--------QPN------------QAEIAADNADIFLKPGGYLMLAIKARSIDVTKDPKEIFKEEIK  196 (226)
T ss_pred             --CCCCCEEEEECC--------CHH------------HHHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCHHHHHHHHHH
T ss_conf             --565658996067--------742------------8999999999860159889999974235646898999999999


Q ss_pred             HHH-CCCCCEEEEEECCCCC
Q ss_conf             852-1788469998145896
Q gi|255764482|r  156 ACA-RRIGSLEITPLHPREG  174 (225)
Q Consensus       156 ~~~-~~~~~~~i~~v~~~~~  174 (225)
T Consensus       197 ~L~~~~~~~~e~i~L~py~~  216 (226)
T PRK04266        197 KLEEGGFEILEVVDLEPYHK  216 (226)
T ss_pred             HHHHCCCCEEEEEECCCCCC
T ss_conf             99876996689981577678