HHsearch alignment for GI: 255764482 and conserved domain: PRK05396

>PRK05396 tdh L-threonine 3-dehydrogenase; Validated.
Probab=96.29  E-value=0.067  Score=29.93  Aligned_cols=102  Identities=16%  Similarity=0.171  Sum_probs=60.7

Q ss_pred             CCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             98557899958784-38999999867998899998898999988999998066452225302004442353100001235
Q gi|255764482|r    9 ATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLK   87 (225)
Q Consensus         9 ~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~   87 (225)
T Consensus       161 ~~~g~~VlV~GaG~vGl~~~~~ak~~Ga~~Vi~~d~~~~kl~~a~~----lGa---~~~i~~~~~~~~~~~~----~~t~  229 (341)
T PRK05396        161 DLVGEDVLITGAGPIGIMAAAVAKHVGARHVVITDVNEYRLELARK----MGA---TRAVNVAKEDLRDVMA----ELGM  229 (341)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCHHHHHHHHH----CCC---CEEEECCCHHHHHHHH----HHHC
T ss_conf             7788869998997543299999998499289999489999998986----499---4999688506899999----9748


Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             7652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   88 NNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        88 ~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
T Consensus       230 ~~G~Dvvid~~------------------------G~~~~~~~~~~~l~~gG~vv~~G  263 (341)
T PRK05396        230 TEGFDVGLEMS------------------------GAPSAFRQMLDAMNHGGRIAMLG  263 (341)
T ss_pred             CCCCEEEEECC------------------------CCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99976999878------------------------98999999999863598999995