HHsearch alignment for GI: 255764482 and conserved domain: PRK07102

>PRK07102 short chain dehydrogenase; Provisional.
Probab=93.63  E-value=0.49  Score=25.06  Aligned_cols=85  Identities=16%  Similarity=0.118  Sum_probs=56.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHC--CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             789995878438999999867--998899998898999988999998066452225302004442353100001235765
Q gi|255764482|r   13 FHLADLGAGAGAAGLAVASRL--HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNNF   90 (225)
Q Consensus        13 ~~VLDlGcG~G~~~l~la~r~--~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~   90 (225)
T Consensus         2 K~vlITGassG-IG~a~A~~la~~G~~v~l~~R~~~~l~~~~~~l~~~~----~~~~~~~~~D~~~~~~~~~~~~~~~~~   76 (243)
T PRK07102          2 KKILIIGATSD-IARACARRYAAAGARLYLAARDTERLERIAADLEARG----AVAVATHELDILDTARHAAFLDNLPAL   76 (243)
T ss_pred             CEEEEECCCHH-HHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCC----CCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             97999157459-9999999999879989999898899999999998535----862899843403699999999998753


Q ss_pred             CCEEEECCCCCC
Q ss_conf             205772265446
Q gi|255764482|r   91 YDHVIMNPPFNE  102 (225)
Q Consensus        91 fDlii~nPPy~~  102 (225)
T Consensus        77 ~d~~v~~aG~~~   88 (243)
T PRK07102         77 PDTVLIAVGTLG   88 (243)
T ss_pred             CCEEEEEEECCC
T ss_conf             797999730367