HHsearch alignment for GI: 255764482 and conserved domain: PRK07402

>PRK07402 precorrin-6B methylase; Provisional.
Probab=99.60  E-value=2.2e-13  Score=94.73  Aligned_cols=123  Identities=16%  Similarity=0.181  Sum_probs=91.2

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867998899998898999988999998066452225302004442353100001
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLA   84 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~   84 (225)
T Consensus        34 ~kL~l~~~~~vwDIGaGtGsVsiEaa~~~~~g~V~AIE~~~~a~~li~~N~~rfgv~n----v~ii~g~ape~L~~l---  106 (196)
T PRK07402         34 SQLRLEPDSVLWDIGAGTGTIPVEAALLCPKGRVIAIERDEEVANLIRRNCDRFGVKN----VEVIEGSAPECLAQL---  106 (196)
T ss_pred             HHHCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC----EEEEECCCHHHHHHC---
T ss_conf             9708999999999478877999999987899889999768889999999899729998----799972636668408---


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE-CCHHHHHHHHHHHHC
Q ss_conf             235765205772265446446547885455652056689899999999862469837870-288889999998521
Q gi|255764482|r   85 GLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI-ARPQSLIQIVNACAR  159 (225)
Q Consensus        85 ~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i-~~~~~l~~~l~~~~~  159 (225)
T Consensus       107 ---~p~pD~vFI----------------------GGg~~l~~il~~~~~~L~pgGriVinaitLetl~~~~~~l~~  157 (196)
T PRK07402        107 ---APAPDRICI----------------------EGGRPIKEILQAVWQYLKPGGRLVATASSLEGLYAISEGLAQ  157 (196)
T ss_pred             ---CCCCCEEEE----------------------CCCCCHHHHHHHHHHHCCCCCEEEEEEEEHHHHHHHHHHHHH
T ss_conf             ---999999998----------------------489688999999998679998999985709889999999997