HHsearch alignment for GI: 255764482 and conserved domain: PRK10258

>PRK10258 biotin biosynthesis protein BioC; Provisional.
Probab=99.73  E-value=4e-17  Score=115.86  Aligned_cols=121  Identities=20%  Similarity=0.210  Sum_probs=92.9

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
T Consensus        34 Ll~~l~~~~~~~vLDlGcGtG~~t~~l~~~--~~~v~~~Dls~~Ml~~a~~~~~---------~~~~~~~D~e~Lp----   98 (251)
T PRK10258         34 LLAMLPQRKFTHVLDAGCGPGWMSRYWRER--GSQVTALDLSPPMLAQARQKDA---------ADHYLAGDIESLP----   98 (251)
T ss_pred             HHHHCCCCCCCCEEEEEEHHHHHHHHHHHC--CCEEEEEECCHHHHHHHHHHCC---------CHHHHHCHHHHCC----
T ss_conf             997366578993999831002789999974--9969999598999999987486---------3343536063099----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC-CHHHHHHHHHHHHC
Q ss_conf             012357652057722654464465478854556520566898999999998624698378702-88889999998521
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA-RPQSLIQIVNACAR  159 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~-~~~~l~~~l~~~~~  159 (225)
T Consensus        99 ---~~~~sfDli~S~~~lqW~------------------~d~~~~l~e~~rvLkPgG~l~fst~g~~tl~ELr~a~~~  155 (251)
T PRK10258         99 ---LATATFDLAWSNLAVQWC------------------GNLSTALRELYRVVRPGGVVAFTTLVQGSLPELHQAWQA  155 (251)
T ss_pred             ---CCCCCCCEEEECCCHHHC------------------CCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             ---987882178550404525------------------999999999996458994999981575768999999998