HHsearch alignment for GI: 255764482 and conserved domain: PRK10309

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional.
Probab=96.63  E-value=0.045  Score=30.89  Aligned_cols=106  Identities=17%  Similarity=0.217  Sum_probs=60.9

Q ss_pred             HHCCCCCCCEEEEECCCH-HHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             438998557899958784-3899999986799889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGA-GAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~-G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
T Consensus       154 ~~~~~~~g~~vlV~GaG~vGl~aiq~ak~~Ga~~V~~~d~~~~kl~~a~~l----GAd~---~i~~~~~~~-----~~~~  221 (347)
T PRK10309        154 HLAQGCEGKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDINSEKLALAKSL----GAMQ---TFNSREMSA-----PQIQ  221 (347)
T ss_pred             HHCCCCCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC----CCCE---EECCCCCCH-----HHHH
T ss_conf             650588898699989983899999999985997699992899999999972----9989---986887799-----9999


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             12357652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
T Consensus       222 ~~~~~~~~d~vvid-----------------------~~G~~~~~~~a~~~~~~~G~iv~~G  260 (347)
T PRK10309        222 SVLRELRFDQLILE-----------------------TAGVPQTVELAIEIAGPRAQLALVG  260 (347)
T ss_pred             HHHCCCCCCEEEEE-----------------------CCCCHHHHHHHHHHHCCCEEEEEEE
T ss_conf             98629988869997-----------------------9999899999999618974999980