HHsearch alignment for GI: 255764482 and conserved domain: PRK10742

>PRK10742 putative methyltransferase; Provisional.
Probab=97.45  E-value=0.002  Score=38.52  Aligned_cols=94  Identities=22%  Similarity=0.332  Sum_probs=67.2

Q ss_pred             CCHHHCCCCCCC--EEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCC-----CCCCCEEECCCC
Q ss_conf             662438998557--8999587843899999986799889999889899998899999806645-----222530200444
Q gi|255764482|r    2 ILASLVNATGSF--HLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQ-----ISKRISLIEVDV   74 (225)
Q Consensus         2 lLa~~~~~~~~~--~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~-----~~~~~~~~~~D~   74 (225)
T Consensus        77 ~lakAvG~k~~~~P~VlDATAGLGrDAfvLAsl--Gc~VtliER~Pvv~aLL~DgL~RA~~~~e~~~~i~~Rm~L~~gds  154 (250)
T PRK10742         77 AVAKAVGIKGDYLPDVVDATAGLGRDAFVLASV--GCRVRMLERNPVVAALLDDGLARGYADAEIGGWLQERLQLIHASS  154 (250)
T ss_pred             HHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHHHHCCHHHHHHHHHCEEECCCH
T ss_conf             667875667899981898788746889999817--986999978899999999999998738155899996167865868


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             23531000012357652057722654464
Q gi|255764482|r   75 TLVGENRNLAGLKNNFYDHVIMNPPFNER  103 (225)
Q Consensus        75 ~~~~~~~~~~~~~~~~fDlii~nPPy~~~  103 (225)
T Consensus       155 ~~~L~~------~~~~~DVIYLDPMFP~r  177 (250)
T PRK10742        155 LTALTD------ITPRPQVVYLDPMFPHK  177 (250)
T ss_pred             HHHHHH------CCCCCCEEEECCCCCCC
T ss_conf             999973------58898889973667765