HHsearch alignment for GI: 255764482 and conserved domain: PRK10901

>PRK10901 16S rRNA methyltransferase B; Provisional.
Probab=99.55  E-value=2.2e-13  Score=94.73  Aligned_cols=133  Identities=15%  Similarity=0.115  Sum_probs=97.6

Q ss_pred             CCHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCC
Q ss_conf             66243899855789995878438999999867998899998898999988999998066452225302004442353100
Q gi|255764482|r    2 ILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENR   81 (225)
Q Consensus         2 lLa~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~   81 (225)
T Consensus       236 l~~~ll~p~~g~~VLD~CAaPGGKt~~la~~~~~~~v~A~D~~~~Rl~~l~~n~~Rlg~~-----~~v~~~d~~~~~---  307 (428)
T PRK10901        236 GCVTLLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRLGMK-----ATVKQGDGRYPS---  307 (428)
T ss_pred             HHHHHCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHCCCC-----EEEEECCCCCHH---
T ss_conf             899864988898798716887668999999645892899969888999999999975997-----399977655723---


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCC-CCCHHHHHH---HCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             00123576520577226544644654-788545565---2056689899999999862469837870
Q gi|255764482|r   82 NLAGLKNNFYDHVIMNPPFNERIGTM-TPDKIKEEA---HVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        82 ~~~~~~~~~fDlii~nPPy~~~~~~~-~~~~~~~~a---~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       308 --~~~~~~~fD~ILlDaPCSg~G~lrR~Pdikw~~~~~di~~l~~lQ~~iL~~a~~~lk~gG~LvYs  372 (428)
T PRK10901        308 --QWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQSEILDAIWPHLKSGGTLVYA  372 (428)
T ss_pred             --HHCCCCCCCEEEECCCCCCCEEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             --31344567879975898887244468542112899999999999999999999866889889999