HHsearch alignment for GI: 255764482 and conserved domain: PRK10909

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional.
Probab=99.15  E-value=4.5e-10  Score=76.03  Aligned_cols=107  Identities=20%  Similarity=0.173  Sum_probs=79.3

Q ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             85578999587843899999986799889999889899998899999806645222530200444235310000123576
Q gi|255764482|r   10 TGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGLKNN   89 (225)
Q Consensus        10 ~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~   89 (225)
T Consensus        51 i~~~~vLDLFAGSGalGlEALSR-GA~~v~fVE~~~~~~~~i~~N~~~l~~----~~~~ii~~da~~~L~------~~~~  119 (198)
T PRK10909         51 IVDARCLDCFAGSGALGLEALSR-YAAGATLLEMDRAVSQQLIKNLATLKA----GNARVVNTNALSFLA------QPGT  119 (198)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCC----CCEEEEEHHHHHHHH------CCCC
T ss_conf             29987998277746889999987-997899997899999999999998488----867999556999862------5599


Q ss_pred             CCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHH--HHHCCCCCEEEEECC
Q ss_conf             520577226544644654788545565205668989999999--986246983787028
Q gi|255764482|r   90 FYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTA--CAIMRSSGQLSLIAR  146 (225)
Q Consensus        90 ~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a--~~lLkpgG~~~~i~~  146 (225)
T Consensus       120 ~fDlIF~DPPY~~~-------------------~~~~~l~~l~~~~~L~~~gliiiE~~  159 (198)
T PRK10909        120 PHNVVFVDPPFRKG-------------------LLEETINLLEQNGWLADDALIYVESE  159 (198)
T ss_pred             CEEEEEECCCCCCC-------------------HHHHHHHHHHHCCCCCCCCEEEEEEC
T ss_conf             52189989997655-------------------59999999998889189969999954