HHsearch alignment for GI: 255764482 and conserved domain: PRK11188

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional.
Probab=99.19  E-value=2.1e-10  Score=77.88  Aligned_cols=146  Identities=12%  Similarity=0.133  Sum_probs=96.4

Q ss_pred             CCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC-CCC
Q ss_conf             9855789995878438999999867-99889999889899998899999806645222530200444235310000-123
Q gi|255764482|r    9 ATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL-AGL   86 (225)
Q Consensus         9 ~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~-~~~   86 (225)
T Consensus        49 ~~~~~~VlDLGaAPG~WsQva~~~~~~~g~VigVDl~~~~p---------------i~gv~~i~gDi~~~~~~~~i~~~~  113 (209)
T PRK11188         49 FKPGMTVVDLGAAPGGWSQYAVTQIGDKGRVIACDILPMDP---------------IVGVDFLQGDFRDELVLKALLERV  113 (209)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECCCCCC---------------CCCCEEECCCCCCHHHHHHHHHHH
T ss_conf             57899899806899757899999739997399986530453---------------789676403445889999999985


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE-ECCHHHHHHHHHHHHCCCCCEE
Q ss_conf             576520577226544644654788545565205668989999999986246983787-0288889999998521788469
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL-IARPQSLIQIVNACARRIGSLE  165 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~-i~~~~~l~~~l~~~~~~~~~~~  165 (225)
T Consensus       114 ~~~~~DvVlSDmAPn~-tG~~~~D~~------~s~~L~~~al~~a~~~Lk~gG~fv~K~F~G~~~~~~~~~~k~~F~~V-  185 (209)
T PRK11188        114 GDSKVDVVMSDMAPNM-SGTPAVDIP------RAMYLVELALDMCRQVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKV-  185 (209)
T ss_pred             CCCCCCEEECCCCCCC-CCCHHHHHH------HHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHCCCCEE-
T ss_conf             8987308966666566-787033599------99999999999999862679889999964879999999997025978-


Q ss_pred             EEEECCCCCCCCE
Q ss_conf             9981458969830
Q gi|255764482|r  166 ITPLHPREGECAS  178 (225)
Q Consensus       166 i~~v~~~~~~~~~  178 (225)
T Consensus       186 -~~~KP~ASR~~S  197 (209)
T PRK11188        186 -KVRKPDSSRARS  197 (209)
T ss_pred             -EEECCCCCCCCC
T ss_conf             -899986746678