HHsearch alignment for GI: 255764482 and conserved domain: PRK11207

>PRK11207 tellurite resistance protein TehB; Provisional.
Probab=99.47  E-value=7.7e-13  Score=91.66  Aligned_cols=109  Identities=16%  Similarity=0.161  Sum_probs=81.2

Q ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCC
Q ss_conf             89985578999587843899999986799889999889899998899999806645222530200444235310000123
Q gi|255764482|r    7 VNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNLAGL   86 (225)
Q Consensus         7 ~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~   86 (225)
T Consensus        26 ~~~~~~g~~LDlgcG~Grna~~La~~--G~~VtavD~s~~al~~~~~~a~~~~l~----~v~~~~~Dl~~~~--------   91 (198)
T PRK11207         26 VKVVKPGRTLDLGCGNGRNSLYLAAN--GYDVTAWDKNPMSIANLERIKAAENLD----NLHTRVVDLNNLT--------   91 (198)
T ss_pred             HCCCCCCCEEEECCCCCHHHHHHHHC--CCEEEEEECCHHHHHHHHHHHHHCCCC----EEEEEEECCCCCC--------
T ss_conf             33589974777247887869999868--985999979999999999999875998----2465620312388--------


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             57652057722654464465478854556520566898999999998624698378702
Q gi|255764482|r   87 KNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLIA  145 (225)
Q Consensus        87 ~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i~  145 (225)
T Consensus        92 ~~~~yDlIlstvv~~fl----------------~p~~~p~iia~mq~~t~PGG~~LIV~  134 (198)
T PRK11207         92 FDGEYDFILSTVVLMFL----------------EAKTIPGLIANMQRCTKPGGYNLIVA  134 (198)
T ss_pred             CCCCCCEEEEEEEEEEC----------------CHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             77770589786452104----------------86678999999999608994899999