HHsearch alignment for GI: 255764482 and conserved domain: PRK11705

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional.
Probab=99.51  E-value=1.8e-13  Score=95.18  Aligned_cols=107  Identities=14%  Similarity=0.206  Sum_probs=83.1

Q ss_pred             CHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCC
Q ss_conf             62438998557899958784389999998679988999988989999889999980664522253020044423531000
Q gi|255764482|r    3 LASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRN   82 (225)
Q Consensus         3 La~~~~~~~~~~VLDlGcG~G~~~l~la~r~~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~   82 (225)
T Consensus       159 i~~kl~l~~G~~VLeIGcGWGgla~~aA~~~-g~~VtgiTlS~eQ~~~a~~r~~--gl-----~v~v~l~DYRd~-----  225 (383)
T PRK11705        159 ICRKLQLKPGMRVLDIGCGWGGLARYAAEHY-GVSVVGVTISAEQQKLAQERCA--GL-----PVEIRLQDYRDL-----  225 (383)
T ss_pred             HHHHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCEEEEEECCHHHHHHHHHHHC--CC-----CCEEEECCHHHC-----
T ss_conf             9986489999979885787499999999974-9759998588999999999973--89-----878997152443-----


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEE
Q ss_conf             0123576520577226544644654788545565205668989999999986246983787
Q gi|255764482|r   83 LAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSL  143 (225)
Q Consensus        83 ~~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~  143 (225)
T Consensus       226 -----~g~fD~IvSIeM~--------------E--hVG~~~~~~yF~~i~~lLkp~G~~~l  265 (383)
T PRK11705        226 -----NGQFDRIVSVGMF--------------E--HVGPKNYRTYFEVVDRCLKPDGLFLL  265 (383)
T ss_pred             -----CCCCCEEEEEEHH--------------H--HCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             -----6773559997148--------------6--52877799999999985699973999