HHsearch alignment for GI: 255764482 and conserved domain: PRK11873

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed.
Probab=99.84  E-value=5.6e-20  Score=131.97  Aligned_cols=111  Identities=19%  Similarity=0.273  Sum_probs=93.9

Q ss_pred             HHCCCCCCCEEEEECCCHHHHHHHHHHHC-CCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCC
Q ss_conf             43899855789995878438999999867-99889999889899998899999806645222530200444235310000
Q gi|255764482|r    5 SLVNATGSFHLADLGAGAGAAGLAVASRL-HEAQILLAERSPLMAHYARKTLALPANAQISKRISLIEVDVTLVGENRNL   83 (225)
Q Consensus         5 ~~~~~~~~~~VLDlGcG~G~~~l~la~r~-~~~~v~gvD~~~~~~~~A~~n~~~~~~~~~~~~~~~~~~D~~~~~~~~~~   83 (225)
T Consensus        67 ~~a~l~pGe~VLDLGcG~G~d~~~aA~~VG~~G~ViGVD~s~~ML~~Ar~~a~~~G~~N----VeF~~Gdae~LP-----  137 (258)
T PRK11873         67 ALAELKPGETVLDLGSGAGFDCFLAARRVGPTGKVIGVDMTPEMLAKARANARKAGYTN----VEFRLGEIEALP-----  137 (258)
T ss_pred             CCCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCC----EEEEEECCCCCC-----
T ss_conf             54657999989994788777599999986999779998599999999999999759975----599995553136-----


Q ss_pred             CCCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             1235765205772265446446547885455652056689899999999862469837870
Q gi|255764482|r   84 AGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVMLEDSFEKWIRTACAIMRSSGQLSLI  144 (225)
Q Consensus        84 ~~~~~~~fDlii~nPPy~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~a~~lLkpgG~~~~i  144 (225)
T Consensus       138 --l~D~SfDvViSncVlnl~------------------pDk~~vl~E~~RVLKPGGRl~IS  178 (258)
T PRK11873        138 --VADGSVDVIISNCVINLS------------------PDKERVFREAFRVLKPGGRFAIS  178 (258)
T ss_pred             --CCCCCEEEEEECCEEECC------------------CCHHHHHHHHHHHCCCCCEEEEE
T ss_conf             --898835199882467607------------------98799999999962889789999